Pelecanus crispus (Dalmatian pelican): 104034978 Help Entry 104034978         CDS       T08340                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism pcri  Pelecanus crispus (Dalmatian pelican) Brite KEGG Orthology (KO) [BR:pcri00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcri03037]     104034978 (TMEM218) Cilium and associated proteins [BR:pcri03037]  Primary cilia and associated proteins   MKS complex    104034978 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  104034978 NCBI-ProteinID:  XP_009486390 LinkDB All DBs Position Unknown AA seq 44 aa AA seqDB search IVDTFFIGRFVLLALMSLVLLGCLFLLLIYHLMEPMYAKPLHSS NT seq 135 nt NT seq  +upstreamnt  +downstreamnt attgtggacaccttctttattggccgctttgtcctcctggcactgatgagcctggtcttg cttgggtgcctgttcctgctcctgatttaccacctcatggagccgatgtacgccaaacca ctccacagcagctag

DBGET integrated database retrieval system