Pelecanus crispus (Dalmatian pelican): 104036416 Help Entry 104036416         CDS       T08340                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri03272   Virion - Hepatitis viruses pcri04382   Cornified envelope formation pcri04514   Cell adhesion molecule (CAM) interaction pcri04530   Tight junction Brite KEGG Orthology (KO) [BR:pcri00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104036416 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104036416 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104036416 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104036416 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcri03037]     104036416 (CLDN19)    04147 Exosome [BR:pcri04147]     104036416 (CLDN19) Cilium and associated proteins [BR:pcri03037]  Other cilia and associated proteins   Stereociliary proteins    104036416 (CLDN19) Exosome [BR:pcri04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104036416 (CLDN19)   Exosomal proteins of colorectal cancer cells    104036416 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CD20 SK_channel Motif Other DBs NCBI-GeneID:  104036416 NCBI-ProteinID:  XP_009488289 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search VHIQTSRALMVISLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGVLFILSGLCTL AAVSLYATRVTYEFFRESTVPINARYEFGSALFIGGPPSLPVLGGSLLCCSCPAKERRGQ QYYRQSQPSTAREYV NT seq 408 nt NT seq  +upstreamnt  +downstreamnt gttcacatccagacctcccgggctctcatggtgatttcactcctcctgggcttcttcggc atcattgtgagcgtggtgggcatgaaatgcaccaaagttggcgaagaggatcccgttacc aagagccgcatcgctgttgccggtggtgtcctcttcatcctctctggtctgtgcacattg gccgctgtgtccttgtacgcgacacgggtgacctacgagttcttcagagagagcaccgtc cccatcaacgccagatacgaattcggctcggctctcttcataggggggccccccagcctc cccgtgctggggggctccctcctgtgctgctcctgccccgccaaggagcggcgaggacag cagtactaccggcagtcgcagccttccacagctcgggagtacgtctga

DBGET integrated database retrieval system