Penicillium rubens: N7525_010720 Help Entry N7525_010720      CDS       T01091                                  Name (RefSeq) uncharacterized protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism pcs  Penicillium rubens Pathway pcs03020   RNA polymerase pcs03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pcs00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     N7525_010720   09124 Replication and repair    03420 Nucleotide excision repair     N7525_010720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pcs03021]     N7525_010720    03400 DNA repair and recombination proteins [BR:pcs03400]     N7525_010720 Transcription machinery [BR:pcs03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      N7525_010720   RNA polymerase III system    RNA polymerase III      N7525_010720   RNA polymerase I system    RNA polymerase I      N7525_010720 DNA repair and recombination proteins [BR:pcs03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       N7525_010720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 KOW Motif Other DBs NCBI-GeneID:  8315901 NCBI-ProteinID:  XP_002561341 UniProt:  B6H9E7 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MSDYGHDDDVEETYDYEPGEDVFDEEPEEQEGLEGEDGVEGEEYPTTNGENVVVSGDPNA GYAGKVMEQSREKKVPNDQRTTTPYLTKYERARVLGTRALQISMNAPVLVDLEGETDPLQ IAMKELNQKKIPLIIRRYLPDGWYEDWTCEELL NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtctgactacggccacgacgacgacgtcgaagagacctacgactacgagcccggcgag gatgtgtttgatgaggagccggaggaacaagagggcctcgagggcgaagacggggttgag ggagaagaataccccaccaccaatggcgaaaatgtcgttgtctctggcgatcccaatgcc ggatacgcaggaaaagtgatggagcagtcgcgcgagaagaaagtacccaatgaccagcgc actaccaccccatacttgaccaagtacgagcgcgcgcgtgttctcggtacccgtgccctg cagatcagtatgaacgcacccgtccttgtcgacctcgagggtgaaaccgatcccctgcag atcgccatgaaggaattgaaccagaagaagattcccctgatcattcgccgatacctgccc gatggatggtatgaggattggacatgtgaggagctgttgtag

DBGET integrated database retrieval system