Pseudomonas cucumis: PSH97_05405 Help Entry PSH97_05405       CDS       T09632                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism pcuc  Pseudomonas cucumis Brite KEGG Orthology (KO) [BR:pcuc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcuc03036]     PSH97_05405 (ftsB) Chromosome and associated proteins [BR:pcuc03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PSH97_05405 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC NRBF2 ZapB Csm1_N YabA Motif Other DBs NCBI-ProteinID:  WLG85965 LinkDB All DBs Position 1244577..1244855 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSLAQVAELKQQIADQHAENEALLERNRVMDAEV SELKKGMETVEERARHELGMVKDGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctcgtcttgctcttgctgctggccggcctgcagtac cgcctgtgggtgggtaatggcagtctggcgcaagtggccgagctgaagcagcagattgcg gatcaacacgccgagaatgaggcgttgctggagcgtaatcgggtgatggacgccgaagtc agcgaattgaaaaagggcatggagaccgttgaggaacgggctcgtcatgagttgggcatg gtcaaggacggtgaaaccctttaccagttggcccaatga

DBGET integrated database retrieval system