KEGG   Pseudomonas cucumis: PSH97_14745
Entry
PSH97_14745       CDS       T09632                                 
Name
(GenBank) hypothetical protein
Organism
pcuc  Pseudomonas cucumis
SSDB
Other DBs
NCBI-ProteinID: WLG82404
UniProt: A0ABY9EQ18
LinkDB
Position
complement(3244440..3244670)
AA seq 76 aa
MKREQVRERHAEGHISATHVIQNPANPGEWIVFFKKSAGRSFFLVDDNDEVESFSRLDDL
IETVRGLGIKFAEIHM
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaagcgagagcaggtgcgggagcgccatgcagagggtcatatctctgccacccacgtg
attcagaacccggcgaatccgggggaatggatcgtgtttttcaagaaaagcgccgggcgc
agctttttcctggtggatgacaacgatgaagtcgagtccttcagtcgcctcgacgatttg
atcgagaccgtgcgcgggcttgggatcaaattcgccgaaattcatatgtag

DBGET integrated database retrieval system