Pseudomonas cucumis: PSH97_16285 Help Entry PSH97_16285       CDS       T09632                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism pcuc  Pseudomonas cucumis Brite KEGG Orthology (KO) [BR:pcuc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pcuc03110]     PSH97_16285 Enzymes [BR:pcuc01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      PSH97_16285 Chaperones and folding catalysts [BR:pcuc03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     PSH97_16285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase Rotamase_3 Rotamase_2 Mtf2_C Motif Other DBs NCBI-ProteinID:  WLG82688 LinkDB All DBs Position 3616241..3616516 Genome browser AA seq 91 aa AA seqDB search MKAQARHILVKTSEEAEQLKQRIAKGEAFDVLAKKYSTCPSGKRGGDLGEVRPGQMVGVI DAVIFKKPLRVVHGPIKSKFGYHLVQVFYRD NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaagcccaagcccgccatatcctggtgaaaacctcggaagaagccgagcagctcaaa caacgcatcgccaagggtgaagccttcgatgtgctggccaagaaatactccacgtgcccg tccggcaaacgcggcggcgacttgggcgaagtgcggcccgggcagatggtcggcgtgatc gatgcggtgatcttcaaaaaaccgctgcgggtggtgcatgggccgatcaagagcaagttt ggttatcacctggtgcaggtgttttaccgggattga

DBGET integrated database retrieval system