Phascolarctos cinereus (koala): 110192539 Help Entry 110192539         CDS       T05867                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01523   Antifolate resistance pcw04010   MAPK signaling pathway pcw04060   Cytokine-cytokine receptor interaction pcw04064   NF-kappa B signaling pathway pcw04217   Necroptosis pcw04380   Osteoclast differentiation pcw04620   Toll-like receptor signaling pathway pcw04621   NOD-like receptor signaling pathway pcw04623   Cytosolic DNA-sensing pathway pcw04625   C-type lectin receptor signaling pathway pcw04640   Hematopoietic cell lineage pcw04657   IL-17 signaling pathway pcw04659   Th17 cell differentiation pcw04668   TNF signaling pathway pcw04750   Inflammatory mediator regulation of TRP channels pcw04932   Non-alcoholic fatty liver disease pcw04933   AGE-RAGE signaling pathway in diabetic complications pcw04936   Alcoholic liver disease pcw04940   Type I diabetes mellitus pcw05010   Alzheimer disease pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05133   Pertussis pcw05134   Legionellosis pcw05135   Yersinia infection pcw05140   Leishmaniasis pcw05142   Chagas disease pcw05143   African trypanosomiasis pcw05144   Malaria pcw05146   Amoebiasis pcw05152   Tuberculosis pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05168   Herpes simplex virus 1 infection pcw05171   Coronavirus disease - COVID-19 pcw05321   Inflammatory bowel disease pcw05323   Rheumatoid arthritis pcw05332   Graft-versus-host disease pcw05417   Lipid and atherosclerosis pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110192539 (IL1B)    04064 NF-kappa B signaling pathway     110192539 (IL1B)    04668 TNF signaling pathway     110192539 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110192539 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110192539 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110192539 (IL1B)    04620 Toll-like receptor signaling pathway     110192539 (IL1B)    04621 NOD-like receptor signaling pathway     110192539 (IL1B)    04623 Cytosolic DNA-sensing pathway     110192539 (IL1B)    04625 C-type lectin receptor signaling pathway     110192539 (IL1B)    04659 Th17 cell differentiation     110192539 (IL1B)    04657 IL-17 signaling pathway     110192539 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     110192539 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     110192539 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110192539 (IL1B)    05164 Influenza A     110192539 (IL1B)    05162 Measles     110192539 (IL1B)    05168 Herpes simplex virus 1 infection     110192539 (IL1B)    05163 Human cytomegalovirus infection     110192539 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     110192539 (IL1B)    05135 Yersinia infection     110192539 (IL1B)    05133 Pertussis     110192539 (IL1B)    05134 Legionellosis     110192539 (IL1B)    05152 Tuberculosis     110192539 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     110192539 (IL1B)    05144 Malaria     110192539 (IL1B)    05140 Leishmaniasis     110192539 (IL1B)    05142 Chagas disease     110192539 (IL1B)    05143 African trypanosomiasis     110192539 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     110192539 (IL1B)    05321 Inflammatory bowel disease     110192539 (IL1B)    05332 Graft-versus-host disease     110192539 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     110192539 (IL1B)    05020 Prion disease     110192539 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     110192539 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110192539 (IL1B)    05418 Fluid shear stress and atherosclerosis     110192539 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110192539 (IL1B)    04936 Alcoholic liver disease     110192539 (IL1B)    04932 Non-alcoholic fatty liver disease     110192539 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     110192539 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     110192539 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110192539 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110192539 (IL1B) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interleukins    110192539 (IL1B) Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Cytokines    110192539 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  110192539 NCBI-ProteinID:  XP_020819412 UniProt:  A0A6P5IAW1 LinkDB All DBs Position Unknown AA seq 270 aa AA seqDB search MAVVPEITCEEVDFYRDNDDSQFYEADGPNQKKGYFQYPDLCSKESFLEEDAIQLKFTSQ PHQFHQTVMVVVAIEKMKHLNGLCSQLFQDNDLMNIFTSIFQEEPVTFKSCEIYQSDSAF QFVSSQDCTIQDINQKCLALSKTSELQALHLNGRNISQQVIFNMKYFLGEIGSQKTHVVL CIKKNNLYLSCVMRGEKPILQLEQITDFPSTNVEKRFIFNKIEINHTTEFESAEYPNWYI STSQLDDQPVFLGNIRGGKDITDFILDELS NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggcagtggtacctgaaatcacatgtgaggaggtggatttttacagggacaatgatgac agccaattttatgaggctgatggtcccaaccaaaagaagggttatttccagtatcctgat ctttgctccaaagaaagttttctggaggaggatgccatccagctgaaatttacctctcag ccccatcaattccatcaaactgtgatggtagttgttgcaattgagaagatgaagcatctg aatggactctgctcccagcttttccaggataatgacttgatgaatattttcacaagcatc tttcaagaagaacctgtcaccttcaagagctgtgaaatctatcagtccgactccgccttt cagtttgtatcctcccaagattgcaccattcaggacataaatcaaaaatgcctggccttg tccaagaccagtgaactgcaagctctccatctcaatggtcgcaacataagccaacaagta attttcaacatgaagtacttccttggtgagataggctcccagaaaacacatgtggtcctg tgtatcaagaaaaataatctttatctgtcttgtgtgatgcgtggtgagaagcccattctg cagctggagcaaatcactgatttccccagcactaatgtggaaaagcgattcatcttcaac aagatagaaatcaatcatacaactgaatttgagtctgcagaataccccaactggtacatc agcacatctcaactggatgatcagcctgtcttcctggggaacattagagggggcaaggac ataaccgacttcattttggatgaactctcttaa

DBGET integrated database retrieval system