Phascolarctos cinereus (koala): 110193495 Help Entry 110193495         CDS       T05867                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04613   Neutrophil extracellular trap formation pcw05034   Alcoholism pcw05203   Viral carcinogenesis pcw05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcw00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110193495  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110193495   09163 Immune disease    05322 Systemic lupus erythematosus     110193495   09165 Substance dependence    05034 Alcoholism     110193495  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcw03036]     110193495   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcw04147]     110193495 Chromosome and associated proteins [BR:pcw03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110193495 Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110193495 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  110193495 NCBI-ProteinID:  XP_020821017 UniProt:  A0A6P5IFQ3 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MKGTVMKIPRVAATVNRGFISAEKRSRCMRTIPGKKKEFYSSYIAKILKQVHQDFSGYSW ALDILGSLDNWLFEQAILEAVRLSFFNHRQVVTTREVIEALKQVLPEGWT NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgaagggaacagtgatgaaaattccaagggtagcagctacagttaacaggggcttcatc agtgctgagaaaaggagtagatgcatgaggacaatccctgggaagaagaaagagttctat tccagttacattgctaaaatcctaaagcaagttcatcaggatttcagtggctatagctgg gccctggatatcctggggtcgttagataactggctgtttgagcaggctatcctggaggca gtcaggttatccttcttcaaccacaggcaagtggtcaccaccagagaagtgatcgaggca ttgaagcaggtgctcccagaaggatggacgtga

DBGET integrated database retrieval system