Phascolarctos cinereus (koala): 110195579 Help Entry 110195579         CDS       T05867                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pcw  Phascolarctos cinereus (koala) Pathway pcw00480   Glutathione metabolism pcw00980   Metabolism of xenobiotics by cytochrome P450 pcw00982   Drug metabolism - cytochrome P450 pcw00983   Drug metabolism - other enzymes pcw01100   Metabolic pathways pcw01524   Platinum drug resistance pcw05200   Pathways in cancer pcw05204   Chemical carcinogenesis - DNA adducts pcw05215   Prostate cancer pcw05225   Hepatocellular carcinoma pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     110195579 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     110195579 (GSTP1)    00982 Drug metabolism - cytochrome P450     110195579 (GSTP1)    00983 Drug metabolism - other enzymes     110195579 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110195579 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     110195579 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     110195579 (GSTP1)    05215 Prostate cancer     110195579 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110195579 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110195579 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcw02000]     110195579 (GSTP1) Enzymes [BR:pcw01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      110195579 (GSTP1) Transporters [BR:pcw02000]  Other transporters   Pores ion channels [TC:1]    110195579 (GSTP1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_2 GST_N_3 GST_C_2 Motif Other DBs NCBI-GeneID:  110195579 NCBI-ProteinID:  XP_020824069 UniProt:  A0A6P5IZQ6 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTITYFPIRGRCEAIRMLLADQGQTWKEDVVTPDTWMKGDLKATCLYGQLPKFTDGD LILYQSNAVLRYLGRKYGLYGKDDQEAAVLDMANDGVEDLRLKYIHLIYQNYEEGKDKYV KDLPTQLKPFETLLKQNQGGKAFIVGDKISFADYNLLDVLLIHQTLAPGCLDTFPLLSAY VAGLSSRPNLKAFLASPQRAGRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgcctccctacaccatcacctacttccccatccgagggcgatgcgaggccattcggatg ctcctggctgaccagggccagacctggaaggaggacgtagtgaccccagacacgtggatg aagggggacctcaaggccacctgtctctacggccagctccccaaattcacagatggagat ttgatcttgtaccagagcaatgccgtgctgagatacctgggacgcaaatatgggctctat gggaaggatgatcaagaagctgctgtcttggacatggctaatgatggggtggaggatctc cgactcaaatacatacacctcatctaccagaattatgaggagggcaaggacaagtatgtg aaagacctgcctacccagctgaagccttttgagaccctgctgaagcagaaccagggaggc aaggcctttatcgtgggggacaagatctcttttgcggattacaacctgctggacgtgctg ctgattcaccagacactggcccctggctgtcttgacaccttccctttactgtctgcctat gtagctgggctctcctcccgccccaacctcaaggccttcctggcctcaccccaacgtgct ggtcgccccatcaatggcaatggcaaacagtga

DBGET integrated database retrieval system