Phascolarctos cinereus (koala): 110197190 Help Entry 110197190         CDS       T05867                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04010   MAPK signaling pathway pcw04014   Ras signaling pathway pcw04015   Rap1 signaling pathway pcw04022   cGMP-PKG signaling pathway pcw04066   HIF-1 signaling pathway pcw04068   FoxO signaling pathway pcw04072   Phospholipase D signaling pathway pcw04081   Hormone signaling pcw04114   Oocyte meiosis pcw04140   Autophagy - animal pcw04150   mTOR signaling pathway pcw04151   PI3K-Akt signaling pathway pcw04152   AMPK signaling pathway pcw04211   Longevity regulating pathway pcw04213   Longevity regulating pathway - multiple species pcw04810   Regulation of actin cytoskeleton pcw04910   Insulin signaling pathway pcw04911   Insulin secretion pcw04913   Ovarian steroidogenesis pcw04914   Progesterone-mediated oocyte maturation pcw04917   Prolactin signaling pathway pcw04923   Regulation of lipolysis in adipocytes pcw04930   Type II diabetes mellitus pcw04931   Insulin resistance pcw04932   Non-alcoholic fatty liver disease pcw04940   Type I diabetes mellitus pcw04950   Maturity onset diabetes of the young pcw04960   Aldosterone-regulated sodium reabsorption pcw05010   Alzheimer disease pcw05215   Prostate cancer pcw05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110197190 (INS)    04015 Rap1 signaling pathway     110197190 (INS)    04066 HIF-1 signaling pathway     110197190 (INS)    04068 FoxO signaling pathway     110197190 (INS)    04072 Phospholipase D signaling pathway     110197190 (INS)    04022 cGMP-PKG signaling pathway     110197190 (INS)    04151 PI3K-Akt signaling pathway     110197190 (INS)    04152 AMPK signaling pathway     110197190 (INS)    04150 mTOR signaling pathway     110197190 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     110197190 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110197190 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     110197190 (INS)    04923 Regulation of lipolysis in adipocytes     110197190 (INS)    04913 Ovarian steroidogenesis     110197190 (INS)    04917 Prolactin signaling pathway     110197190 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     110197190 (INS)   09149 Aging    04211 Longevity regulating pathway     110197190 (INS)    04213 Longevity regulating pathway - multiple species     110197190 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     110197190 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     110197190 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     110197190 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     110197190 (INS)    04940 Type I diabetes mellitus     110197190 (INS)    04950 Maturity onset diabetes of the young     110197190 (INS)    04932 Non-alcoholic fatty liver disease     110197190 (INS)    04931 Insulin resistance     110197190 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110197190 (INS) Cytokines and neuropeptides [BR:pcw04052]  Neuropeptides   Unclassified    110197190 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  110197190 NCBI-ProteinID:  XP_020826540 UniProt:  A0A6P5IWP1 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MAPWLAALSLTVLLALSSPPASEALVNQHLCGSHLVEALYLVCGERGFFYTPKARRDAEQ PLLGEAGGEELPFPPEYQLQKRGIVEQCCNSICSLYQLETYCN NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggctccctggttggctgccctgtccctgacggtcctgctggcattgtccagcccaccg gccagtgaagccctcgtcaaccagcacctatgtggctcccacctggtggaggccttgtac ctggtgtgtggggagaggggcttcttctacacccccaaagcacgccgggacgcggagcag ccactgctgggtgaggccggaggggaagagctgcccttcccccccgagtaccagctgcag aaacgtggcatcgtcgagcagtgctgcaacagtatctgctccctctaccagctggagacc tattgcaactag

DBGET integrated database retrieval system