Phascolarctos cinereus (koala): 110198074 Help Entry 110198074         CDS       T05867                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04022   cGMP-PKG signaling pathway pcw04081   Hormone signaling pcw04270   Vascular smooth muscle contraction pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     110198074 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     110198074 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     110198074 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110198074 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110198074 (NPPC) Cytokines and neuropeptides [BR:pcw04052]  Neuropeptides   Unclassified    110198074 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP DUF1180 Motif Other DBs NCBI-GeneID:  110198074 NCBI-ProteinID:  XP_020827832 UniProt:  A0A6P5J0D6 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MHVSQLLAWTLLLTLLSLRPEAKPAAPQKPPRTPPGEEVAGLLAAAGGDKKGDKAPGGGG GGGGGANAKGSNARLLRDLRVDSRSRAAWARLLHDYPNARKFRGVNKKGLSKGCFGLKLD RIGSMSGLGC NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgcacgtctcccaactgctggcctggacgctgcttctgacgctcctctcgcttcgtccc gaggccaagccagccgcgccgcagaagcccccgcggaccccgcccggagaagaggtggcg gggctcctggccgcagccggcggggacaagaagggggacaaggcgccggggggcggcggc ggcggcggcggtggggccaatgccaagggctccaacgcgcggctgcttcgcgacctgcgc gtggacagccgctcgagggcggcttgggcacgcctgctgcacgactatcccaacgcacgc aagttccgaggcgtcaacaagaagggcttgtccaagggctgcttcggcctcaagctggac cggatcggttccatgagcggcctgggatgctaa

DBGET integrated database retrieval system