Phascolarctos cinereus (koala): 110198481 Help Entry 110198481         CDS       T05867                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04081   Hormone signaling pcw04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     110198481 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     110198481 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110198481 (GAST) Cytokines and neuropeptides [BR:pcw04052]  Neuropeptides   GPCR binding    110198481 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  110198481 NCBI-ProteinID:  XP_020828439 UniProt:  A0A6P5JBD5 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MRQLWGCVLISALALSTFSEASPKPKALLQDTPPGPEASRSLGMRWPTALRSPSHYRRQL HPQDLPHLMADLSKKQGPWQEEEEAYGWMDFGRRSAEERDQLP NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcggcagctgtgggggtgtgtgctgatctctgccctggccctgtccaccttctctgaa gcctctccaaagcccaaagccctgctccaggacactcctccaggccctgaagccagcagg agcctgggaatgcgatggccaactgctctgagatctccttcccactaccggagacaactc caccctcaggaccttcctcacctcatggcagatctatccaagaagcaaggaccatggcag gaagaggaggaggcatatggctggatggactttggacgccgcagtgccgaggaaagggac cagctcccctag

DBGET integrated database retrieval system