Phascolarctos cinereus (koala): 110199039 Help Entry 110199039         CDS       T05867                                  Name (RefSeq) calmodulin-A-like   KO K02183   calmodulin Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04014   Ras signaling pathway pcw04015   Rap1 signaling pathway pcw04020   Calcium signaling pathway pcw04022   cGMP-PKG signaling pathway pcw04024   cAMP signaling pathway pcw04070   Phosphatidylinositol signaling system pcw04114   Oocyte meiosis pcw04218   Cellular senescence pcw04261   Adrenergic signaling in cardiomyocytes pcw04270   Vascular smooth muscle contraction pcw04371   Apelin signaling pathway pcw04625   C-type lectin receptor signaling pathway pcw04713   Circadian entrainment pcw04720   Long-term potentiation pcw04722   Neurotrophin signaling pathway pcw04728   Dopaminergic synapse pcw04740   Olfactory transduction pcw04744   Phototransduction pcw04750   Inflammatory mediator regulation of TRP channels pcw04910   Insulin signaling pathway pcw04912   GnRH signaling pathway pcw04915   Estrogen signaling pathway pcw04916   Melanogenesis pcw04921   Oxytocin signaling pathway pcw04922   Glucagon signaling pathway pcw04924   Renin secretion pcw04925   Aldosterone synthesis and secretion pcw04970   Salivary secretion pcw04971   Gastric acid secretion pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05031   Amphetamine addiction pcw05034   Alcoholism pcw05133   Pertussis pcw05152   Tuberculosis pcw05163   Human cytomegalovirus infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05214   Glioma pcw05417   Lipid and atherosclerosis pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110199039    04015 Rap1 signaling pathway     110199039    04371 Apelin signaling pathway     110199039    04020 Calcium signaling pathway     110199039    04070 Phosphatidylinositol signaling system     110199039    04024 cAMP signaling pathway     110199039    04022 cGMP-PKG signaling pathway     110199039  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     110199039    04218 Cellular senescence     110199039  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110199039   09152 Endocrine system    04910 Insulin signaling pathway     110199039    04922 Glucagon signaling pathway     110199039    04912 GnRH signaling pathway     110199039    04915 Estrogen signaling pathway     110199039    04921 Oxytocin signaling pathway     110199039    04916 Melanogenesis     110199039    04924 Renin secretion     110199039    04925 Aldosterone synthesis and secretion     110199039   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     110199039    04270 Vascular smooth muscle contraction     110199039   09154 Digestive system    04970 Salivary secretion     110199039    04971 Gastric acid secretion     110199039   09156 Nervous system    04728 Dopaminergic synapse     110199039    04720 Long-term potentiation     110199039    04722 Neurotrophin signaling pathway     110199039   09157 Sensory system    04744 Phototransduction     110199039    04740 Olfactory transduction     110199039    04750 Inflammatory mediator regulation of TRP channels     110199039   09159 Environmental adaptation    04713 Circadian entrainment     110199039  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110199039   09162 Cancer: specific types    05214 Glioma     110199039   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110199039    05163 Human cytomegalovirus infection     110199039    05167 Kaposi sarcoma-associated herpesvirus infection     110199039   09171 Infectious disease: bacterial    05133 Pertussis     110199039    05152 Tuberculosis     110199039   09164 Neurodegenerative disease    05010 Alzheimer disease     110199039    05012 Parkinson disease     110199039    05022 Pathways of neurodegeneration - multiple diseases     110199039   09165 Substance dependence    05031 Amphetamine addiction     110199039    05034 Alcoholism     110199039   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110199039    05418 Fluid shear stress and atherosclerosis     110199039  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcw01009]     110199039   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcw04131]     110199039    03036 Chromosome and associated proteins [BR:pcw03036]     110199039   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcw04147]     110199039 Protein phosphatases and associated proteins [BR:pcw01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110199039 Membrane trafficking [BR:pcw04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110199039 Chromosome and associated proteins [BR:pcw03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110199039 Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110199039 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 EFhand_Ca_insen UPF0154 DUF5580_M Dockerin_1 DUF1103 RNA_pol_Rpb4 Caleosin SurA_N_3 FCaBP_EF-hand SurA_N_2 Fe_hyd_lg_C PhageMin_Tail MotA_activ Motif Other DBs NCBI-GeneID:  110199039 NCBI-ProteinID:  XP_020829378 UniProt:  A0A6P5J7J1 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQFSEEQIAEFKEAFSLFDKDSDGCITTKELGTVMRSLGQNPTEAELKSMIGEIDTDG NGTIDFPEFLSMMARKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLTDD EVDEMIREADVDGDGQVNYEEFVRMLISK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagttttcagaggagcagatcgctgaattcaaagaggctttcagccttttt gacaaggattctgatggctgcatcaccactaaggaactgggcactgtcatgaggtcacta ggccagaaccccacggaggctgagctgaagagcatgattggagagattgatactgatggt aatggtaccattgattttcctgagttcttgagcatgatggcaaggaagatgaaggacacg gacagtgaggaggagatccgggaggctttccgggtatttgacaaagatggcaacggcttc gtcagtgcagctgagctaaggcatgtgatgaccaaactgggggaaaagctcacagatgat gaagtcgatgagatgatccgggaagctgatgttgatggcgatggccaggtgaactatgag gaatttgtccgcatgcttatctctaagtag

DBGET integrated database retrieval system