Phascolarctos cinereus (koala): 110199249 Help Entry 110199249         CDS       T05867                                  Name (RefSeq) interferon tau-2-like   KO K05414   interferon alpha Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04151   PI3K-Akt signaling pathway pcw04217   Necroptosis pcw04620   Toll-like receptor signaling pathway pcw04621   NOD-like receptor signaling pathway pcw04622   RIG-I-like receptor signaling pathway pcw04623   Cytosolic DNA-sensing pathway pcw04630   JAK-STAT signaling pathway pcw04650   Natural killer cell mediated cytotoxicity pcw04936   Alcoholic liver disease pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05165   Human papillomavirus infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05171   Coronavirus disease - COVID-19 pcw05200   Pathways in cancer pcw05320   Autoimmune thyroid disease pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110199249    04151 PI3K-Akt signaling pathway     110199249   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110199249  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110199249  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110199249    04621 NOD-like receptor signaling pathway     110199249    04622 RIG-I-like receptor signaling pathway     110199249    04623 Cytosolic DNA-sensing pathway     110199249    04650 Natural killer cell mediated cytotoxicity     110199249  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110199249   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110199249    05161 Hepatitis B     110199249    05160 Hepatitis C     110199249    05171 Coronavirus disease - COVID-19     110199249    05164 Influenza A     110199249    05162 Measles     110199249    05168 Herpes simplex virus 1 infection     110199249    05163 Human cytomegalovirus infection     110199249    05167 Kaposi sarcoma-associated herpesvirus infection     110199249    05169 Epstein-Barr virus infection     110199249    05165 Human papillomavirus infection     110199249   09171 Infectious disease: bacterial    05152 Tuberculosis     110199249   09163 Immune disease    05320 Autoimmune thyroid disease     110199249   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110199249   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110199249  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110199249 Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interferons    110199249 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  110199249 NCBI-ProteinID:  XP_020829667 UniProt:  A0A6P5JEZ1 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search MTSGTFLPVALVLLCSSTLCSLGCDLTQGLLEDFSLLNQMSPFSLGPCWKDRTNFNFPKE ATEGSQLQRENATVIVHEMLQQIFTIFSLSATPAAWNQTQLMQLLSGLDQQLEQLERCLG QDVEWEEPSLGSENPRLALKSYFQGISQYLQGKEYSHCAWEIVRVEIRKIFLFMNKLTRK FRD NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atgacctccgggacctttttgccagttgccctggtgctgctctgctccagcaccctctgc tccctgggctgtgacctgactcagggccttctggaagacttctcacttctgaaccaaatg agcccattttccttgggaccatgttggaaggacaggaccaacttcaacttcccaaaggaa gccacggaaggcagccagctccagagggaaaatgccacagtcatcgttcatgagatgctc cagcagatcttcaccatcttcagcctgagtgccactcctgcagcttggaatcagacccag ctcatgcaactgctcagtggcctggatcagcagctggaacagctggagaggtgtcttggg caggatgtggagtgggaagagccttccttgggaagtgagaaccccaggctggccctgaag agctacttccaaggaataagccagtacctgcaaggtaaagagtatagccactgtgcctgg gaaattgtgagagtagagatcaggaagatctttctgttcatgaacaagctcacaagaaaa ttcagggactga

DBGET integrated database retrieval system