Phascolarctos cinereus (koala): 110199296 Help Entry 110199296         CDS       T05867                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04064   NF-kappa B signaling pathway pcw04668   TNF signaling pathway pcw04940   Type I diabetes mellitus pcw05166   Human T-cell leukemia virus 1 infection pcw05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     110199296 (LTA)    04668 TNF signaling pathway     110199296 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110199296 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     110199296 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110199296 (LTA)    05168 Herpes simplex virus 1 infection     110199296 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110199296 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110199296 (LTA) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Tumor necrosis fators    110199296 (LTA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  110199296 NCBI-ProteinID:  XP_020829723 UniProt:  A0A6P5J691 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MTSSGVLCLLGALSLQVLWLQPPGAQGAPSPDNSHSPSPAPPQTAQHLSQKSPKRDTLKP AAHLVGDPSTQDSIRWRASTDHAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGASCSSE ITPTLLYLSHEVLLFSSKYQVHVPLLSAQKSVCPGTQGPWMRSIYQGAVFLLTQGDLLST HTDGISHLLQSPSSVFFGAFAL NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgacctcatctggagtcctgtgcctcctgggggcgctgagcctccaggtgctttggctg cagccaccaggggctcagggggctcccagtcctgataactcccactcacctagcccagcc ccacctcagacagctcagcatctcagccagaagagcccaaaaagagacaccctcaaacca gctgcccaccttgttggagatcccagcacccaggactctatacgttggagggcaagcaca gaccacgctttcctccgacatggcttctctctaagcaacaactccctgttggtccccaca agcggcctctacttcgtttactctcaggttgtcttctcaggagccagctgttcttctgag attactcccaccctactctacctgagccatgaggtgctcctcttctcctccaagtaccag gttcatgtgcccctcctgagtgcccagaagtctgtgtgcccagggacccaaggaccctgg atgagatcaatctatcaaggagctgtgttcctgcttacccagggagatctgctatctact catacagatggtatctctcacctgctccagtcccctagtagtgtcttttttggggccttt gcactatag

DBGET integrated database retrieval system