Phascolarctos cinereus (koala): 110201965 Help Entry 110201965         CDS       T05867                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04072   Phospholipase D signaling pathway pcw04140   Autophagy - animal pcw04150   mTOR signaling pathway pcw04151   PI3K-Akt signaling pathway pcw04152   AMPK signaling pathway pcw04211   Longevity regulating pathway pcw04218   Cellular senescence pcw04714   Thermogenesis pcw04910   Insulin signaling pathway pcw04919   Thyroid hormone signaling pathway pcw05163   Human cytomegalovirus infection pcw05165   Human papillomavirus infection pcw05168   Herpes simplex virus 1 infection pcw05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     110201965 (RHEB)    04151 PI3K-Akt signaling pathway     110201965 (RHEB)    04152 AMPK signaling pathway     110201965 (RHEB)    04150 mTOR signaling pathway     110201965 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110201965 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     110201965 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     110201965 (RHEB)    04919 Thyroid hormone signaling pathway     110201965 (RHEB)   09149 Aging    04211 Longevity regulating pathway     110201965 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     110201965 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     110201965 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     110201965 (RHEB)    05163 Human cytomegalovirus infection     110201965 (RHEB)    05165 Human papillomavirus infection     110201965 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pcw04031]     110201965 (RHEB) GTP-binding proteins [BR:pcw04031]  Small (monomeric) G-proteins   Ras Family    Rheb     110201965 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  110201965 NCBI-ProteinID:  XP_020833557 UniProt:  A0A6P5JH10 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgctatcctggggtaccggtccgtggggaaatcc tcattgacaattcagtttgttgaaggccagtttgttgactcttatgatccaaccatagaa aacacatttacaaaattgatcacagtaaatggacaagaatatcatcttcagctggtagac acagctgggcaagatgagtactccatctttcctcagacgtactccatagacattaatggt tatattcttgtgtattcagttacatcaatcaaaagttttgaagtgattaaagttatccat ggcaagttgttggatatggtggggaaagtccagatacctattatgttggttgggaataag aaagacctgcatatggaacgagtgatcagttatgaagaagggaaagctttagcggaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgttttt aggaggataattttggaggcagaaaaaattgatggggcagcttcacaagggaagtcttca tgctcagtaatgtaa

DBGET integrated database retrieval system