Phascolarctos cinereus (koala): 110203147 Help Entry 110203147         CDS       T05867                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04814   Motor proteins pcw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     110203147 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110203147 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcw03037]     110203147 (DYNLT3)    04812 Cytoskeleton proteins [BR:pcw04812]     110203147 (DYNLT3) Cilium and associated proteins [BR:pcw03037]  Motile cilia and associated proteins   Dynein arm    110203147 (DYNLT3) Cytoskeleton proteins [BR:pcw04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      110203147 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  110203147 NCBI-ProteinID:  XP_020835284 UniProt:  A0A6P5JVV8 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MEEYQPHHEEIGFNADEAHNIVKECIDAILGGVDYNQNNVNQWTAAIVEQSLTHLVKLGK TYKIYRFHTYEIKHYFVKVTCAVMQKSGSGLHTASSCFWDTTSDGTCTVRWENQTMNCIV NVFAIAIIL NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggaggaatatcagccccaccacgaagagattggcttcaatgctgatgaagcacacaat attgtgaaagagtgtatagatgctatattgggcggtgtggattataatcagaataatgtc aaccaatggactgcagctatagtggaacaatccttaacacatttggtaaaattagggaag acgtataaaatatatagatttcatacctatgaaatcaaacattactttgttaaagttact tgtgcagtaatgcagaagagtggatctggtttacacacagccagctcatgtttttgggac actacatctgatggaacctgtaccgtaagatgggagaatcaaactatgaactgtatcgtc aatgtttttgccattgctattatcctgtaa

DBGET integrated database retrieval system