Phascolarctos cinereus (koala): 110204780 Help Entry 110204780         CDS       T05867                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04015   Rap1 signaling pathway pcw04810   Regulation of actin cytoskeleton pcw05014   Amyotrophic lateral sclerosis pcw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110204780 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110204780 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110204780 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110204780 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcw04131]     110204780 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcw04812]     110204780 (PFN2)    04147 Exosome [BR:pcw04147]     110204780 (PFN2) Membrane trafficking [BR:pcw04131]  Others   Actin-binding proteins    Others     110204780 (PFN2) Cytoskeleton proteins [BR:pcw04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110204780 (PFN2) Exosome [BR:pcw04147]  Exosomal proteins   Proteins found in most exosomes    110204780 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110204780 NCBI-ProteinID:  XP_020836551 UniProt:  A0A6P5JWQ0 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggatgctgccaggaggcc gccattgtcggctactgcgacgccaagtacgtgtgggcggccaccgctgggggcatcttc cagagcatcacgccaatagaaatagacatgattgtaggaaaagatcgagagggtttcttt accaatggtttgactcttggtgcaaagaagtgctcagtaatcagagatagtctgtatgtg gacggtgactgcacaatggacatcaggacaaagagtcaaggaggtgaaccgacatataat gttgctgtgggcagagctggccgagtcttggtctttgtaatgggcaaagaaggggtccat ggaggtggattgaataagaaggcatactcaatggccaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system