Phascolarctos cinereus (koala): 110204864 Help Entry 110204864         CDS       T05867                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04810   Regulation of actin cytoskeleton pcw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110204864 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110204864 (BRK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil Motif Other DBs NCBI-GeneID:  110204864 NCBI-ProteinID:  XP_020836667 UniProt:  A0A6P5JQU7 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIELITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcggggcaggaggatccggtgcagcgggagatccaccaggactgggcgaaccgcgag tacatcgagctcatcaccagcagcattaagaagatcgcggacttccttaattcgttcgat atgtcctgtcgttcaaggcttgcaacactaaatgagaaactgactgccctggaacggaga atcgagtacattgaagcaagggtaacaaagggcgagacccttacctag

DBGET integrated database retrieval system