Phascolarctos cinereus (koala): 110205518 Help Entry 110205518         CDS       T05867                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04613   Neutrophil extracellular trap formation pcw05034   Alcoholism pcw05202   Transcriptional misregulation in cancer pcw05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcw00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110205518  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110205518   09163 Immune disease    05322 Systemic lupus erythematosus     110205518   09165 Substance dependence    05034 Alcoholism     110205518  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcw03036]     110205518   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcw04147]     110205518 Chromosome and associated proteins [BR:pcw03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110205518 Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110205518 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  110205518 NCBI-ProteinID:  XP_020837803 UniProt:  A0A6P5LL69 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcaaactgcccgtaaatccaccggtggtaaagcccccaggaagcag ctcgctacaaaagccgctcgcaagagtgcgccctctactggaggggtcaagaaacctcat cgctacaggccgggtactgtggctctccgtgaaatcaggcgttatcaaaagtccaccgaa cttctgattcgtaaacttcccttccagcgtctggtgcgtgaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagcaattggtgctttgcaggaggcaagtgaagcctat ctggttggcctgtttgaggacaccaacctatgtgctatccacgccaaacgtgtcacaatc atgccaaaagatatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system