Phascolarctos cinereus (koala): 110208590 Help Entry 110208590         CDS       T05867                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04814   Motor proteins pcw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcw00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     110208590 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110208590 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcw03037]     110208590 (DYNLT1)    04812 Cytoskeleton proteins [BR:pcw04812]     110208590 (DYNLT1) Cilium and associated proteins [BR:pcw03037]  Motile cilia and associated proteins   Dynein arm    110208590 (DYNLT1) Cytoskeleton proteins [BR:pcw04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      110208590 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  110208590 NCBI-ProteinID:  XP_020842363 UniProt:  A0A6P5KA41 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDDFQASEETSFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNTSDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgatttccaggcttccgaggagacttcttttgtggttgatgaagtgagtaacatt gtaaaagaggccatagaaagcgcaattggtggtaacgcttatcaacacagcaaagtcaat cagtggaccacaaatgtagtggaacaaactttaagtcaacttaccaagttggggaaaccg ttcaagtacattgtgacctgtgtgattatgcagaagaatggagctgggctgcatacagca agctcttgcttttgggataacaccagtgatggaagctgcactgtgagatgggagaataag accatgtactgtatagttagtgcctttggactgtccatttaa

DBGET integrated database retrieval system