Phascolarctos cinereus (koala): 110209035 Help Entry 110209035         CDS       T05867                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04014   Ras signaling pathway pcw04137   Mitophagy - animal pcw04144   Endocytosis pcw04145   Phagosome pcw04148   Efferocytosis pcw04962   Vasopressin-regulated water reabsorption pcw05014   Amyotrophic lateral sclerosis pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05146   Amoebiasis pcw05152   Tuberculosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110209035 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110209035 (RAB5A)    04145 Phagosome     110209035 (RAB5A)    04137 Mitophagy - animal     110209035 (RAB5A)    04148 Efferocytosis     110209035 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     110209035 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110209035 (RAB5A)    05152 Tuberculosis     110209035 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     110209035 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110209035 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     110209035 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcw04131]     110209035 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcw04147]     110209035 (RAB5A)    04031 GTP-binding proteins [BR:pcw04031]     110209035 (RAB5A) Membrane trafficking [BR:pcw04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     110209035 (RAB5A)  Endosome - Lysosome transport     110209035 (RAB5A) Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110209035 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    110209035 (RAB5A)   Exosomal proteins of colorectal cancer cells    110209035 (RAB5A)   Exosomal proteins of bladder cancer cells    110209035 (RAB5A) GTP-binding proteins [BR:pcw04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     110209035 (RAB5A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  110209035 NCBI-ProteinID:  XP_020842863 UniProt:  A0A6P5KBK8 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALAGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaaccgaggagcaacaagacccaatgggccaaatactgggaataaaatttgccag ttcaaactagtacttcttggcgaatctgctgttggaaaatcaagtcttgtgcttcgattt gtgaagggtcaatttcatgaatttcaagagagtaccattggggctgcttttctaacccag actgtatgtctggatgatacaacagtaaaatttgaaatatgggatacagctggacaagaa agatatcatagcttagcaccaatgtattacagaggcgcacaagcagcaatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaactgggttaaagaacttcagagg caagcaagtcctaatattgtaatagctttagcagggaacaaggctgatctagcaaataaa agagctgtagatttccaggaagcacagtcttatgcagatgacaacagtttattattcatg gagacgtcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagccaaaaag ttgccgaagaatgaaccacagaatccaggagccaattctgccagaggaagaggtgtagat cttaccgaacccacacaaccaactaggagtcagtgttgtagtaactaa

DBGET integrated database retrieval system