Phascolarctos cinereus (koala): 110209216 Help Entry 110209216         CDS       T05867                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pcw  Phascolarctos cinereus (koala) Brite KEGG Orthology (KO) [BR:pcw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pcw03041]     110209216   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110209216 Spliceosome [BR:pcw03041]  Complex B   Other components    Complex B specific factors     110209216 Cytokines and neuropeptides [BR:pcw04052]  Neuropeptides   Unclassified    110209216 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  110209216 NCBI-ProteinID:  XP_020843172 UniProt:  A0A6P5KER8 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRPGKKVRVKCSPDDSIGDLKKLVAAQTGTRWNKIVLKKWYMVFKDHVTLGDY EIHDVMSLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtgtgcaacgacaggccgggcaagaaggtccgtgtgaagtgcagcccc gacgactccatcggggacctgaagaagctggttgcggctcagacgggcacccgttggaac aagatcgtcctgaagaagtggtacatggtgttcaaggaccacgtgacgctgggggactat gaaatccacgacgtaatgagcctggagctgtattaccaatag

DBGET integrated database retrieval system