Phascolarctos cinereus (koala): 110210080 Help Entry 110210080         CDS       T05867                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04620   Toll-like receptor signaling pathway pcw04622   RIG-I-like receptor signaling pathway pcw04625   C-type lectin receptor signaling pathway pcw04630   JAK-STAT signaling pathway pcw04658   Th1 and Th2 cell differentiation pcw04936   Alcoholic liver disease pcw04940   Type I diabetes mellitus pcw05133   Pertussis pcw05134   Legionellosis pcw05140   Leishmaniasis pcw05142   Chagas disease pcw05143   African trypanosomiasis pcw05144   Malaria pcw05145   Toxoplasmosis pcw05146   Amoebiasis pcw05152   Tuberculosis pcw05162   Measles pcw05164   Influenza A pcw05168   Herpes simplex virus 1 infection pcw05171   Coronavirus disease - COVID-19 pcw05200   Pathways in cancer pcw05321   Inflammatory bowel disease pcw05330   Allograft rejection pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110210080 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110210080 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110210080 (IL12A)    04622 RIG-I-like receptor signaling pathway     110210080 (IL12A)    04625 C-type lectin receptor signaling pathway     110210080 (IL12A)    04658 Th1 and Th2 cell differentiation     110210080 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110210080 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110210080 (IL12A)    05164 Influenza A     110210080 (IL12A)    05162 Measles     110210080 (IL12A)    05168 Herpes simplex virus 1 infection     110210080 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     110210080 (IL12A)    05134 Legionellosis     110210080 (IL12A)    05152 Tuberculosis     110210080 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     110210080 (IL12A)    05144 Malaria     110210080 (IL12A)    05145 Toxoplasmosis     110210080 (IL12A)    05140 Leishmaniasis     110210080 (IL12A)    05142 Chagas disease     110210080 (IL12A)    05143 African trypanosomiasis     110210080 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     110210080 (IL12A)    05330 Allograft rejection     110210080 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110210080 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110210080 (IL12A)    04936 Alcoholic liver disease     110210080 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110210080 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110210080 (IL12A) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interleukins    110210080 (IL12A) Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Cytokines    110210080 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 HR1 RHH_1 Motif Other DBs NCBI-GeneID:  110210080 NCBI-ProteinID:  XP_020844515 UniProt:  A0A6P5KFZ6 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MESRRHASLRYIFLIATLIGLSQVNWAKSLPVTQPEPSMPQCLRGSKNLLEAVSNTLQKA RQKLELYSCSLQEIDHEDITEVRTSTVRDCIPPELTKNGSCLVSRKTLCVKHCCLKSIYE DLEIYKAEFNVIKETLAKDPTRQISLDQNMLAAIDEMMQALNFNSENAPLVSSPKEPDFY KTKVKLCILLHAFRIRAVTINRMMSFLTASS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggagtcacgccgccacgctagcctccgatatatcttcctcattgccacacttattggc cttagccaagtcaactgggccaaaagccttcctgtgacacagcctgaacccagcatgccc cagtgtctcagaggctccaagaacctgttggaggctgtaagcaacactcttcaaaaggca agacaaaaacttgaactgtactcttgttccttgcaagaaattgatcatgaagatatcact gaagtcagaaccagcacagtgagggactgcataccaccagaattaaccaagaatggaagc tgcctggtttccagaaagacactttgtgttaagcactgttgccttaaaagcatctatgag gacctggagatctataaggctgagtttaatgtgatcaaggaaactcttgcaaaggaccct acaagacagatttctctggaccaaaatatgttggctgctattgatgagatgatgcaggcc ctgaatttcaacagtgagaatgcgccactggtctcttcacccaaagaacctgacttttac aagactaaggtcaagctctgcatcctccttcacgctttcagaatccgggccgtgaccatc aatagaatgatgagcttcctgaccgcttcttcgtga

DBGET integrated database retrieval system