Phascolarctos cinereus (koala): 110210853 Help Entry 110210853         CDS       T05867                                  Name (RefSeq) ubiquitin-like   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism pcw  Phascolarctos cinereus (koala) Pathway pcw03010   Ribosome pcw04120   Ubiquitin mediated proteolysis pcw04137   Mitophagy - animal pcw04140   Autophagy - animal pcw05012   Parkinson disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:pcw00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     110210853   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110210853  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110210853    04137 Mitophagy - animal     110210853  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110210853    05167 Kaposi sarcoma-associated herpesvirus infection     110210853   09164 Neurodegenerative disease    05012 Parkinson disease     110210853    05022 Pathways of neurodegeneration - multiple diseases     110210853  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:pcw03011]     110210853    04121 Ubiquitin system [BR:pcw04121]     110210853   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcw04147]     110210853 Ribosome [BR:pcw03011]  Ribosomal proteins   Eukaryotes    Small subunit     110210853   Archaea     110210853 Ubiquitin system [BR:pcw04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    110210853 Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110210853   Exosomal proteins of colorectal cancer cells    110210853 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Ubiquitin_5 Dsc3_N DUF2604 TBK1_ULD UBL_UBAC1 Ribosomal_S27 Ribosomal_L33 HemeBinding_Shp Motif Other DBs NCBI-GeneID:  110210853 NCBI-ProteinID:  XP_020845599 UniProt:  A0A6P5KKT5 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search MQSALENHLHSLSDLPSTCGPSATMQIFMKTLTGKTITLEVELSDTIENVKAKIQDKEGI PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLHGGAKKRKKSYTTPKNNKHKRKK VKLAVLKYCKVDKNGKISRLR NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgcaatctgctttggaaaatcatttgcactctctttcggatctgccatcaacgtgtgga cccagtgccacgatgcagattttcatgaagactttgacagggaagaccattacgcttgag gtcgaactgtctgatactattgaaaatgtcaaggccaagatacaagataaggaaggtatt ccccctgatcaacaaagattgatttttgcgggcaagcaactggaagatggtcgaactttg tctgactacaacattcagaaggagtctacccttcatcttgttctaaggcttcatggtggt gccaagaagagaaagaagtcttataccactccaaaaaacaacaagcataagagaaagaag gttaagcttgcagttctaaagtactgtaaggttgataagaatggcaagattagccgcctt cgatga

DBGET integrated database retrieval system