Phascolarctos cinereus (koala): 110211412 Help Entry 110211412         CDS       T05867                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01521   EGFR tyrosine kinase inhibitor resistance pcw01524   Platinum drug resistance pcw04014   Ras signaling pathway pcw04064   NF-kappa B signaling pathway pcw04115   p53 signaling pathway pcw04137   Mitophagy - animal pcw04140   Autophagy - animal pcw04151   PI3K-Akt signaling pathway pcw04210   Apoptosis pcw04215   Apoptosis - multiple species pcw04621   NOD-like receptor signaling pathway pcw04630   JAK-STAT signaling pathway pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05022   Pathways of neurodegeneration - multiple diseases pcw05145   Toxoplasmosis pcw05162   Measles pcw05166   Human T-cell leukemia virus 1 infection pcw05168   Herpes simplex virus 1 infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05202   Transcriptional misregulation in cancer pcw05212   Pancreatic cancer pcw05220   Chronic myeloid leukemia pcw05222   Small cell lung cancer pcw05225   Hepatocellular carcinoma pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110211412 (BCL2L1)    04630 JAK-STAT signaling pathway     110211412 (BCL2L1)    04064 NF-kappa B signaling pathway     110211412 (BCL2L1)    04151 PI3K-Akt signaling pathway     110211412 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110211412 (BCL2L1)    04137 Mitophagy - animal     110211412 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     110211412 (BCL2L1)    04215 Apoptosis - multiple species     110211412 (BCL2L1)    04115 p53 signaling pathway     110211412 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110211412 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110211412 (BCL2L1)    05202 Transcriptional misregulation in cancer     110211412 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     110211412 (BCL2L1)    05225 Hepatocellular carcinoma     110211412 (BCL2L1)    05220 Chronic myeloid leukemia     110211412 (BCL2L1)    05222 Small cell lung cancer     110211412 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110211412 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     110211412 (BCL2L1)    05162 Measles     110211412 (BCL2L1)    05168 Herpes simplex virus 1 infection     110211412 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110211412 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     110211412 (BCL2L1)    05014 Amyotrophic lateral sclerosis     110211412 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     110211412 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110211412 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110211412 (BCL2L1)    01524 Platinum drug resistance     110211412 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pcw01009]     110211412 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcw03036]     110211412 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcw02000]     110211412 (BCL2L1) Protein phosphatases and associated proteins [BR:pcw01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      110211412 (BCL2L1) Chromosome and associated proteins [BR:pcw03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     110211412 (BCL2L1) Transporters [BR:pcw02000]  Other transporters   Pores ion channels [TC:1]    110211412 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 PROCT Motif Other DBs NCBI-GeneID:  110211412 NCBI-ProteinID:  XP_020846347 UniProt:  A0A6P5KNP0 LinkDB All DBs Position Unknown AA seq 227 aa AA seqDB search MSHSNRELVVDFLSYKLSQKGYSWSQFEDENRTEAPEGTEIPSTVNGSPSWHPADSHAVS GATGHSSSLDAHETIPVAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQV VNELFRDGVNWGRIVAFFSFGGALCVESVDKEMEVLVGRITSWMATYLDDHLDPWIQENG GWDTFVELYGNDAAAESRKGQERFNRWLLTGMTVAGVVLLGSLFSRK NT seq 684 nt NT seq  +upstreamnt  +downstreamnt atgtctcacagcaaccgggagctggtggttgactttctttcttacaagctctcacagaaa ggatacagttggagtcaatttgaagatgagaataggactgaggccccagaagggacagaa atacctagtactgtgaatggcagcccctcttggcaccctgctgacagccatgcagtgagt ggggccacaggacacagcagcagcctggatgcccatgagacaataccggtggctgctgtg aagcaagctttgagggaggcaggagatgaatttgaactccggtaccgaagggccttcagt gacctgacatcccagctccacatcactccagggacggcttatcagagctttgagcaggta gtgaatgaactctttcgggatggggtgaactggggccgaattgtggcattcttctccttc ggaggggcattgtgtgtggaaagcgtggataaggagatggaagtcttggtaggacgaatc acctcctggatggccacttacttggatgaccacctagacccttggatccaagaaaatggc ggttgggacaccttcgtggagctttatgggaacgatgcagctgcagagagccggaagggc caggaacgcttcaaccgatggctgctgactggcatgacagtggctggtgtagtcctgctg gggtccctgttcagccggaagtga

DBGET integrated database retrieval system