Phascolarctos cinereus (koala): 110213139 Help Entry 110213139         CDS       T05867                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism pcw  Phascolarctos cinereus (koala) Pathway pcw00190   Oxidative phosphorylation pcw01100   Metabolic pathways pcw01524   Platinum drug resistance pcw04115   p53 signaling pathway pcw04210   Apoptosis pcw04215   Apoptosis - multiple species pcw04932   Non-alcoholic fatty liver disease pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05017   Spinocerebellar ataxia pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05134   Legionellosis pcw05145   Toxoplasmosis pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05210   Colorectal cancer pcw05222   Small cell lung cancer pcw05416   Viral myocarditis pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     110213139  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110213139    04215 Apoptosis - multiple species     110213139    04115 p53 signaling pathway     110213139  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110213139   09162 Cancer: specific types    05210 Colorectal cancer     110213139    05222 Small cell lung cancer     110213139   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110213139    05161 Hepatitis B     110213139    05160 Hepatitis C     110213139    05164 Influenza A     110213139    05162 Measles     110213139    05168 Herpes simplex virus 1 infection     110213139    05163 Human cytomegalovirus infection     110213139    05167 Kaposi sarcoma-associated herpesvirus infection     110213139    05169 Epstein-Barr virus infection     110213139   09171 Infectious disease: bacterial    05132 Salmonella infection     110213139    05134 Legionellosis     110213139    05152 Tuberculosis     110213139   09174 Infectious disease: parasitic    05145 Toxoplasmosis     110213139   09164 Neurodegenerative disease    05010 Alzheimer disease     110213139    05012 Parkinson disease     110213139    05014 Amyotrophic lateral sclerosis     110213139    05016 Huntington disease     110213139    05017 Spinocerebellar ataxia     110213139    05020 Prion disease     110213139    05022 Pathways of neurodegeneration - multiple diseases     110213139   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110213139    05416 Viral myocarditis     110213139   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110213139   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110213139 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  110213139 NCBI-ProteinID:  XP_020849044 UniProt:  A0A6P5KWN9 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLNGLFGRKTGQSPGFTYTDANKNKGIIW GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgacgtggagaagggcaagaagatctttgttcagaagtgtgctcagtgccacact gtcgagaaggggggcaagcacaagacggggcccaatctgaacggcctttttggccgaaag accggccagtctccgggcttcacctatacagatgccaacaagaacaaaggtatcatctgg ggagaggatacgctgatggagtacctggaaaaccccaagaagtatatccctggaaccaaa atgatcttcgcaggcattaagaagaagggagaaagggcagacttgatagcataccttaag aaggccaccaatgagtaa

DBGET integrated database retrieval system