Phascolarctos cinereus (koala): 110214590 Help Entry 110214590         CDS       T05867                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04066   HIF-1 signaling pathway pcw04120   Ubiquitin mediated proteolysis pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pcw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110214590 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     110214590 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110214590 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     110214590 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110214590 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcw04121]     110214590 (ELOB)    03400 DNA repair and recombination proteins [BR:pcw03400]     110214590 (ELOB) Ubiquitin system [BR:pcw04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110214590 (ELOB)    Cul5 complex      110214590 (ELOB) DNA repair and recombination proteins [BR:pcw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110214590 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110214590 NCBI-ProteinID:  XP_020851238 UniProt:  A0A6P5KZ20 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDSKTLGEC GFTSQTARPQAPATVGLAFRADDVFETLRIESFSSPPELPDVMKPQDSGSGTNEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcctaatgatccggcgccacaagacaacgatcttcacagatgcgaaggag tcgagcacagtgtttgaactgaagcgcattgtggaaggcatcctcaagaggcccccggat gagcagcggctctacaaggatgaccagctgctggatgacagtaagaccctgggcgagtgt ggcttcacaagtcagacagccaggcctcaagcaccagccactgtggggctggcctttcga gctgatgatgtatttgaaacactgcgcattgagtccttctccagccctccagaactgcca gatgtcatgaagcctcaagactctggaagtggcaccaatgagcaagctgtgcagtaa

DBGET integrated database retrieval system