Phascolarctos cinereus (koala): 110216558 Help Entry 110216558         CDS       T05867                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pcw  Phascolarctos cinereus (koala) Brite KEGG Orthology (KO) [BR:pcw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pcw03041]     110216558   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110216558 Spliceosome [BR:pcw03041]  Complex B   Other components    Complex B specific factors     110216558 Cytokines and neuropeptides [BR:pcw04052]  Neuropeptides   Unclassified    110216558 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  110216558 NCBI-ProteinID:  XP_020854071 UniProt:  A0A6P5LEW0 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MEVVCKDRLGNKVHVNRNTDDSIGDPKKLIAAETGTGWNMIILKKWYTIFKDHVALGDYE IHDVINLELYYQQG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggaggttgtatgtaaggacaggctgggcaacaaggtccacgtgaatcgcaacactgac gactcaataggagacccaaagaaactgattgcagctgagacaggcaccggttggaacatg attattttaaagaaatggtacacaatcttcaaggaccacgtggctctgggggactatgag atccacgatgtaataaacctagagctttattaccaacaggggtag

DBGET integrated database retrieval system