Phascolarctos cinereus (koala): 110216838 Help Entry 110216838         CDS       T05867                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04015   Rap1 signaling pathway pcw04810   Regulation of actin cytoskeleton pcw05014   Amyotrophic lateral sclerosis pcw05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110216838 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110216838 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110216838 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110216838 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcw04131]     110216838 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pcw04812]     110216838 (PFN3)    04147 Exosome [BR:pcw04147]     110216838 (PFN3) Membrane trafficking [BR:pcw04131]  Others   Actin-binding proteins    Others     110216838 (PFN3) Cytoskeleton proteins [BR:pcw04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110216838 (PFN3) Exosome [BR:pcw04147]  Exosomal proteins   Proteins found in most exosomes    110216838 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110216838 NCBI-ProteinID:  XP_020854503 UniProt:  A0A6P5L916 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKTYISAVLRDQRIDDVAVVGHSDNRCVWASRPGGLLAAITPQEVGILTGPDRRSFL QSGITLAGRRCCVIRDHLLEDGDGVLDARTKGLDGRSVCVGLTPKALIVLMGRRGVHGGT LNKTAHHLIRSLRFQGI NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaagacatacatcagtgccgtactgcgggaccagcgcatcgatgacgtg gcagtggtggggcattcggacaaccgctgcgtgtgggcctcgaggcctggaggcctgctg gctgctatcacccctcaggaggtgggcatactgacaggccctgaccgccgcagctttttg cagtctgggatcaccttggcaggccgacgctgctgcgtcatccgcgaccacctcctagaa gacggcgatggtgttctggacgcccggaccaaggggctggatggtcgctctgtgtgcgtg ggactcacgccaaaggccctgatcgtgctcatgggccgacggggcgtgcacgggggcaca ctcaacaaaactgctcaccatcttatcaggagcctgcggttccagggtatctaa

DBGET integrated database retrieval system