KEGG   Phascolarctos cinereus (koala): 110219182
Entry
110219182         CDS       T05867                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04062  Chemokine signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04137  Mitophagy - animal
pcw04140  Autophagy - animal
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04211  Longevity regulating pathway
pcw04213  Longevity regulating pathway - multiple species
pcw04218  Cellular senescence
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04540  Gap junction
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04625  C-type lectin receptor signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04714  Thermogenesis
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04912  GnRH signaling pathway
pcw04915  Estrogen signaling pathway
pcw04916  Melanogenesis
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04929  GnRH secretion
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04935  Growth hormone synthesis, secretion and action
pcw05010  Alzheimer disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05034  Alcoholism
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05207  Chemical carcinogenesis - receptor activation
pcw05208  Chemical carcinogenesis - reactive oxygen species
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110219182 (NRAS)
   04012 ErbB signaling pathway
    110219182 (NRAS)
   04014 Ras signaling pathway
    110219182 (NRAS)
   04015 Rap1 signaling pathway
    110219182 (NRAS)
   04370 VEGF signaling pathway
    110219182 (NRAS)
   04371 Apelin signaling pathway
    110219182 (NRAS)
   04068 FoxO signaling pathway
    110219182 (NRAS)
   04072 Phospholipase D signaling pathway
    110219182 (NRAS)
   04071 Sphingolipid signaling pathway
    110219182 (NRAS)
   04151 PI3K-Akt signaling pathway
    110219182 (NRAS)
   04150 mTOR signaling pathway
    110219182 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110219182 (NRAS)
   04137 Mitophagy - animal
    110219182 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    110219182 (NRAS)
   04218 Cellular senescence
    110219182 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110219182 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    110219182 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110219182 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110219182 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    110219182 (NRAS)
   04660 T cell receptor signaling pathway
    110219182 (NRAS)
   04662 B cell receptor signaling pathway
    110219182 (NRAS)
   04664 Fc epsilon RI signaling pathway
    110219182 (NRAS)
   04062 Chemokine signaling pathway
    110219182 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110219182 (NRAS)
   04929 GnRH secretion
    110219182 (NRAS)
   04912 GnRH signaling pathway
    110219182 (NRAS)
   04915 Estrogen signaling pathway
    110219182 (NRAS)
   04917 Prolactin signaling pathway
    110219182 (NRAS)
   04921 Oxytocin signaling pathway
    110219182 (NRAS)
   04926 Relaxin signaling pathway
    110219182 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    110219182 (NRAS)
   04919 Thyroid hormone signaling pathway
    110219182 (NRAS)
   04916 Melanogenesis
    110219182 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    110219182 (NRAS)
   04726 Serotonergic synapse
    110219182 (NRAS)
   04720 Long-term potentiation
    110219182 (NRAS)
   04730 Long-term depression
    110219182 (NRAS)
   04722 Neurotrophin signaling pathway
    110219182 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    110219182 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    110219182 (NRAS)
   04213 Longevity regulating pathway - multiple species
    110219182 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    110219182 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110219182 (NRAS)
   05206 MicroRNAs in cancer
    110219182 (NRAS)
   05205 Proteoglycans in cancer
    110219182 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    110219182 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    110219182 (NRAS)
   05203 Viral carcinogenesis
    110219182 (NRAS)
   05230 Central carbon metabolism in cancer
    110219182 (NRAS)
   05231 Choline metabolism in cancer
    110219182 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110219182 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110219182 (NRAS)
   05225 Hepatocellular carcinoma
    110219182 (NRAS)
   05226 Gastric cancer
    110219182 (NRAS)
   05214 Glioma
    110219182 (NRAS)
   05216 Thyroid cancer
    110219182 (NRAS)
   05221 Acute myeloid leukemia
    110219182 (NRAS)
   05220 Chronic myeloid leukemia
    110219182 (NRAS)
   05218 Melanoma
    110219182 (NRAS)
   05211 Renal cell carcinoma
    110219182 (NRAS)
   05219 Bladder cancer
    110219182 (NRAS)
   05215 Prostate cancer
    110219182 (NRAS)
   05213 Endometrial cancer
    110219182 (NRAS)
   05224 Breast cancer
    110219182 (NRAS)
   05223 Non-small cell lung cancer
    110219182 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110219182 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    110219182 (NRAS)
   05161 Hepatitis B
    110219182 (NRAS)
   05160 Hepatitis C
    110219182 (NRAS)
   05163 Human cytomegalovirus infection
    110219182 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110219182 (NRAS)
   05165 Human papillomavirus infection
    110219182 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110219182 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    110219182 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    110219182 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110219182 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110219182 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110219182 (NRAS)
   01522 Endocrine resistance
    110219182 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcw04131]
    110219182 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110219182 (NRAS)
   04031 GTP-binding proteins [BR:pcw04031]
    110219182 (NRAS)
Membrane trafficking [BR:pcw04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    110219182 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110219182 (NRAS)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110219182 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   110219182 (NRAS)
  Exosomal proteins of breast cancer cells
   110219182 (NRAS)
  Exosomal proteins of colorectal cancer cells
   110219182 (NRAS)
GTP-binding proteins [BR:pcw04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110219182 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 110219182
NCBI-ProteinID: XP_020857981
UniProt: A0A6P5LPV7
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CLGLSCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgagtacaaactggtggtggtcggagctggcggtgtggggaaaagcgccttgacc
atccagctcatccagaaccacttcgtagacgagtatgatcccacgatagaggactcgtat
cgaaagcaagtggttattgatggtgaaacctgtttgttggacatacttgacacagctgga
caggaagagtacagtgccatgagagaccagtatatgaggacaggcgaaggctttctctgt
gtctttgccatcaacaatagcaaatcatttgcagatattaacctttacagagaacagatt
aagcgagtgaaagattcagacgatgtacctatggtgctggtgggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaggctcatgaactagccaagagctatggaattcct
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggtc
agagaaatacggcagtaccgcatgaaaaaactcaacagtagcgatgatgggactcaaggc
tgtctgggtctttcgtgtgcagtcatgtaa

DBGET integrated database retrieval system