Phascolarctos cinereus (koala): 110219692 Help Entry 110219692         CDS       T05867                                  Symbol FGF21 Name (RefSeq) fibroblast growth factor 21   KO K22429   fibroblast growth factor 21 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04010   MAPK signaling pathway pcw04014   Ras signaling pathway pcw04015   Rap1 signaling pathway pcw04020   Calcium signaling pathway pcw04151   PI3K-Akt signaling pathway pcw04714   Thermogenesis pcw04810   Regulation of actin cytoskeleton pcw05200   Pathways in cancer pcw05218   Melanoma pcw05224   Breast cancer pcw05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110219692 (FGF21)    04014 Ras signaling pathway     110219692 (FGF21)    04015 Rap1 signaling pathway     110219692 (FGF21)    04020 Calcium signaling pathway     110219692 (FGF21)    04151 PI3K-Akt signaling pathway     110219692 (FGF21)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110219692 (FGF21)  09150 Organismal Systems   09159 Environmental adaptation    04714 Thermogenesis     110219692 (FGF21)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110219692 (FGF21)   09162 Cancer: specific types    05226 Gastric cancer     110219692 (FGF21)    05218 Melanoma     110219692 (FGF21)    05224 Breast cancer     110219692 (FGF21)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110219692 (FGF21)    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110219692 (FGF21) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Growth factors (RTK binding)    110219692 (FGF21) Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Growth factors/receptors    110219692 (FGF21) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  110219692 NCBI-ProteinID:  XP_020858905 UniProt:  A0A6P5LKI7 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MGPRRRARGCLAPLLSLLLAYRGWGYPIPDSSPMLLFGGQVRLRHLYTDDGQDTEAHVEM GPDGAVRAAVERSPDSLLELKAVKPGVIRILAVHSSRFLCMRPSGELYGAVQYDPSACNF REHLLGDGYNVYESEAHGRTLRLSPQASLGQPGPSRFLPLPGAQLPGTEPPWGEGPEPPD VGSADPLSMVGGAQGRSPSYSS NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgggcccaagaaggagagccaggggctgcctggcccctctgctttccctgctcctggcc tataggggctggggctaccctattcccgactccagccccatgctcctgtttgggggtcag gtccgcctgcgccacctgtacacagatgacggccaggacaccgaggcccacgtggagatg gggcccgacggcgcagtgcgagcagcggtggagaggagccccgacagtcttctagagctg aaggcagtgaagcctggtgttatccgaatcctggcggtccacagctctcggtttctgtgc atgaggcccagtggcgagctgtacggagcggtacaatatgacccttctgcctgcaacttt cgggaacatctgctgggggatggctataatgtgtatgaatcggaggctcatgggcggacc ctccgtctgtccccccaggcctctctgggccaacctggcccttcccgcttcctgccactt cccggtgcccagctgcctggcaccgagccaccctggggagagggccccgagcccccggac gtgggctcggcagacccactgagcatggtggggggtgcgcagggccgcagccccagctac tcctcgtga

DBGET integrated database retrieval system