Phascolarctos cinereus (koala): 110219776 Help Entry 110219776         CDS       T05867                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01521   EGFR tyrosine kinase inhibitor resistance pcw01522   Endocrine resistance pcw01524   Platinum drug resistance pcw04071   Sphingolipid signaling pathway pcw04115   p53 signaling pathway pcw04141   Protein processing in endoplasmic reticulum pcw04210   Apoptosis pcw04211   Longevity regulating pathway pcw04215   Apoptosis - multiple species pcw04217   Necroptosis pcw04722   Neurotrophin signaling pathway pcw04932   Non-alcoholic fatty liver disease pcw04933   AGE-RAGE signaling pathway in diabetic complications pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05132   Salmonella infection pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05165   Human papillomavirus infection pcw05166   Human T-cell leukemia virus 1 infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05202   Transcriptional misregulation in cancer pcw05203   Viral carcinogenesis pcw05210   Colorectal cancer pcw05212   Pancreatic cancer pcw05213   Endometrial cancer pcw05214   Glioma pcw05216   Thyroid cancer pcw05217   Basal cell carcinoma pcw05218   Melanoma pcw05220   Chronic myeloid leukemia pcw05222   Small cell lung cancer pcw05223   Non-small cell lung cancer pcw05224   Breast cancer pcw05225   Hepatocellular carcinoma pcw05226   Gastric cancer pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110219776 (BAX)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     110219776 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110219776 (BAX)    04215 Apoptosis - multiple species     110219776 (BAX)    04217 Necroptosis     110219776 (BAX)    04115 p53 signaling pathway     110219776 (BAX)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     110219776 (BAX)   09149 Aging    04211 Longevity regulating pathway     110219776 (BAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110219776 (BAX)    05202 Transcriptional misregulation in cancer     110219776 (BAX)    05203 Viral carcinogenesis     110219776 (BAX)   09162 Cancer: specific types    05210 Colorectal cancer     110219776 (BAX)    05212 Pancreatic cancer     110219776 (BAX)    05225 Hepatocellular carcinoma     110219776 (BAX)    05226 Gastric cancer     110219776 (BAX)    05214 Glioma     110219776 (BAX)    05216 Thyroid cancer     110219776 (BAX)    05220 Chronic myeloid leukemia     110219776 (BAX)    05217 Basal cell carcinoma     110219776 (BAX)    05218 Melanoma     110219776 (BAX)    05213 Endometrial cancer     110219776 (BAX)    05224 Breast cancer     110219776 (BAX)    05222 Small cell lung cancer     110219776 (BAX)    05223 Non-small cell lung cancer     110219776 (BAX)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110219776 (BAX)    05170 Human immunodeficiency virus 1 infection     110219776 (BAX)    05161 Hepatitis B     110219776 (BAX)    05160 Hepatitis C     110219776 (BAX)    05164 Influenza A     110219776 (BAX)    05162 Measles     110219776 (BAX)    05168 Herpes simplex virus 1 infection     110219776 (BAX)    05163 Human cytomegalovirus infection     110219776 (BAX)    05167 Kaposi sarcoma-associated herpesvirus infection     110219776 (BAX)    05169 Epstein-Barr virus infection     110219776 (BAX)    05165 Human papillomavirus infection     110219776 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     110219776 (BAX)    05152 Tuberculosis     110219776 (BAX)   09164 Neurodegenerative disease    05012 Parkinson disease     110219776 (BAX)    05014 Amyotrophic lateral sclerosis     110219776 (BAX)    05016 Huntington disease     110219776 (BAX)    05020 Prion disease     110219776 (BAX)    05022 Pathways of neurodegeneration - multiple diseases     110219776 (BAX)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110219776 (BAX)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110219776 (BAX)    04933 AGE-RAGE signaling pathway in diabetic complications     110219776 (BAX)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110219776 (BAX)    01524 Platinum drug resistance     110219776 (BAX)    01522 Endocrine resistance     110219776 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pcw03029]     110219776 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pcw02000]     110219776 (BAX) Mitochondrial biogenesis [BR:pcw03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     110219776 (BAX) Transporters [BR:pcw02000]  Other transporters   Pores ion channels [TC:1]    110219776 (BAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Motif Other DBs NCBI-GeneID:  110219776 NCBI-ProteinID:  XP_020859090 UniProt:  A0A6P5LL18 LinkDB All DBs Position Unknown AA seq 200 aa AA seqDB search MDGYGEQPRGGGDPEATSSEQIMRTGAVLLQGFIQDRAGRVAGGAPELVLDSMGDSAPLP SDPRTKRLTECLRRIGDELDSNMELQRMIAAVETDSPREVFFRVAAEMFSDGNFNWGRVV ALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLTWIQEQGGWDGLLSYFGTPTWQ TVTIFVAGILTASLTIWKMS NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggacggctacggggagcagccgcgaggcggtggcgatccggaggccacgagcagtgag cagatcatgaggaccggggccgtgctgctgcaggggttcatccaggaccgcgcgggccgg gtggctgggggcgcccccgagctggtcctggattccatgggagactcggccccgctgccc tcggacccccggaccaagcggctgaccgagtgcctgcgcaggatcggggacgagctggac agcaacatggagctgcagaggatgatcgccgcggtggagaccgactctccccgggaggtc tttttccgagtggccgccgagatgttctccgacggcaacttcaactggggccgggtcgtg gccctcttctattttgctagcaagcttgtgctcaaggcactctgcaccaaggtcccggag ctgatccgaaccatcatgggctggaccctagacttcctgagagaacggctgctcacctgg atccaggagcagggtggctgggatggcctcctctcttactttgggacaccaacctggcag acagttaccatcttcgtggctggcatccttacagcttcgcttaccatctggaagatgtcc tag

DBGET integrated database retrieval system