Phascolarctos cinereus (koala): 110220158 Help Entry 110220158         CDS       T05867                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04613   Neutrophil extracellular trap formation pcw05034   Alcoholism pcw05203   Viral carcinogenesis pcw05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:pcw00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110220158  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110220158   09163 Immune disease    05322 Systemic lupus erythematosus     110220158   09165 Substance dependence    05034 Alcoholism     110220158  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pcw03036]     110220158 Chromosome and associated proteins [BR:pcw03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110220158 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  110220158 NCBI-ProteinID:  XP_020859736 UniProt:  A0A6P5LUI2 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcagggcgaggaaaaggaggcaaggggctgggtaaagggggtgccaagaggcacagg aaggtgctccgagataacatccagggcatcactaagcccgccatccgccgtctggcccgg cgcggcggcgtcaagcgtatctcggggctcatctacgaggagacccgcggcgtgctgaag gtgttcctggagaacgtgatccgggacgccgtcacctacaccgagcacgccaagaggaag acggtcactgccatggacgtggtctacgcgctcaagcgccagggccggaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system