Phascolarctos cinereus (koala): 110221274 Help Entry 110221274         CDS       T05867                                  Name (RefSeq) C-C motif chemokine 3-like   KO K05408   C-C motif chemokine 3 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04062   Chemokine signaling pathway pcw04620   Toll-like receptor signaling pathway pcw05142   Chagas disease pcw05163   Human cytomegalovirus infection pcw05323   Rheumatoid arthritis pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110221274    04061 Viral protein interaction with cytokine and cytokine receptor     110221274  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110221274    04062 Chemokine signaling pathway     110221274  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     110221274   09174 Infectious disease: parasitic    05142 Chagas disease     110221274   09163 Immune disease    05323 Rheumatoid arthritis     110221274   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110221274  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110221274    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110221274 Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Chemokines    110221274 Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Chemokines    110221274 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110221274 NCBI-ProteinID:  XP_020861402 UniProt:  A0A6P5LS71 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MGVLVAVFSFFLLLLPSGFCLVMSVKHAASTDFVPCCNNFISHRIPQSLVIGFVRTSPQC PKPGVLFETKQGLKVCANPAVHWVQRYIKSLGFN NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggggtcttggtggctgtcttctccttcttccttctcctcctcccttctggcttctgc ttggtgatgtcagtcaagcacgctgcttcaactgactttgtcccctgctgcaacaacttc atcagccatcggatcccacaatctcttgtgatcggttttgttaggaccagcccccagtgc cccaagcctggagttttgtttgaaaccaaacaaggactgaaagtctgtgccaatccagct gtccactgggtccagaggtatatcaaaagcctgggtttcaactaa

DBGET integrated database retrieval system