Phascolarctos cinereus (koala): 110221317 Help Entry 110221317         CDS       T05867                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism pcw  Phascolarctos cinereus (koala) Pathway pcw03272   Virion - Hepatitis viruses pcw04382   Cornified envelope formation pcw04514   Cell adhesion molecules pcw04530   Tight junction pcw04670   Leukocyte transendothelial migration pcw05160   Hepatitis C Brite KEGG Orthology (KO) [BR:pcw00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     110221317 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     110221317 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     110221317 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     110221317 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     110221317 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     110221317 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcw03037]     110221317 (CLDN4)    04147 Exosome [BR:pcw04147]     110221317 (CLDN4)    04515 Cell adhesion molecules [BR:pcw04515]     110221317 (CLDN4) Cilium and associated proteins [BR:pcw03037]  Other cilia and associated proteins   Stereociliary proteins    110221317 (CLDN4) Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    110221317 (CLDN4)   Exosomal proteins of colorectal cancer cells    110221317 (CLDN4) Cell adhesion molecules [BR:pcw04515]  Immunoglobulin superfamily   L1 family    110221317 (CLDN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 TMEM37 DUF7139 DUF7541 DUF4131 Motif Other DBs NCBI-GeneID:  110221317 NCBI-ProteinID:  XP_020861487 UniProt:  A0A6P5LSK3 LinkDB All DBs Position Unknown AA seq 209 aa AA seqDB search MGSMGLQIMGIALAVLGWLASMLSCALPMWRVTAFIGSNIVTAQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALVVICIIVAALGVLLALVGGKCTNCVEDETSKAKTMIV AGIVFILAGILVIIPTSWTAHNIIRDFYNPLVASGQKREMGASLYIGWAASGLLMLGGAL LCCNCPPRSEKSYSAKYTAARSAPTSNYV NT seq 630 nt NT seq  +upstreamnt  +downstreamnt atggggtccatggggctccagataatgggcattgccctggccgtgctgggctggctggct tccatgctgtcctgcgcgctgcccatgtggcgggtgacagccttcattggcagcaacatc gtgactgcccagaccatctgggagggtctatggatgaactgcgtggtccagagcacgggc cagatgcaatgcaaggtgtatgactcgttgttggccctgccccaggacctgcaggctgcc agggccctagtggtcatctgcatcatcgtggcagcactcggcgtccttctggccctggtg ggtggcaagtgtaccaactgtgtggaggatgagacctccaaggccaagaccatgatcgtg gctggcattgtctttatcctggctggcatcctggtcatcattcccacctcctggactgcc cacaacattatccgggacttctacaatcctctggtggcctctggacagaagagggagatg ggtgcctctctgtacattggctgggctgcctcaggcctgcttatgctcggaggggctctg ctgtgctgcaactgcccaccccggagtgagaagtcctactcagctaagtacactgctgcc cgctctgcccccaccagcaactacgtgtag

DBGET integrated database retrieval system