KEGG   Phascolarctos cinereus (koala): 110221918
Entry
110221918         CDS       T05867                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pcw  Phascolarctos cinereus (koala)
Pathway
pcw01521  EGFR tyrosine kinase inhibitor resistance
pcw01522  Endocrine resistance
pcw01524  Platinum drug resistance
pcw04010  MAPK signaling pathway
pcw04012  ErbB signaling pathway
pcw04014  Ras signaling pathway
pcw04015  Rap1 signaling pathway
pcw04022  cGMP-PKG signaling pathway
pcw04024  cAMP signaling pathway
pcw04062  Chemokine signaling pathway
pcw04066  HIF-1 signaling pathway
pcw04068  FoxO signaling pathway
pcw04071  Sphingolipid signaling pathway
pcw04072  Phospholipase D signaling pathway
pcw04114  Oocyte meiosis
pcw04140  Autophagy - animal
pcw04148  Efferocytosis
pcw04150  mTOR signaling pathway
pcw04151  PI3K-Akt signaling pathway
pcw04210  Apoptosis
pcw04218  Cellular senescence
pcw04261  Adrenergic signaling in cardiomyocytes
pcw04270  Vascular smooth muscle contraction
pcw04350  TGF-beta signaling pathway
pcw04360  Axon guidance
pcw04370  VEGF signaling pathway
pcw04371  Apelin signaling pathway
pcw04380  Osteoclast differentiation
pcw04510  Focal adhesion
pcw04520  Adherens junction
pcw04540  Gap junction
pcw04550  Signaling pathways regulating pluripotency of stem cells
pcw04611  Platelet activation
pcw04613  Neutrophil extracellular trap formation
pcw04620  Toll-like receptor signaling pathway
pcw04621  NOD-like receptor signaling pathway
pcw04625  C-type lectin receptor signaling pathway
pcw04650  Natural killer cell mediated cytotoxicity
pcw04657  IL-17 signaling pathway
pcw04658  Th1 and Th2 cell differentiation
pcw04659  Th17 cell differentiation
pcw04660  T cell receptor signaling pathway
pcw04662  B cell receptor signaling pathway
pcw04664  Fc epsilon RI signaling pathway
pcw04666  Fc gamma R-mediated phagocytosis
pcw04668  TNF signaling pathway
pcw04713  Circadian entrainment
pcw04720  Long-term potentiation
pcw04722  Neurotrophin signaling pathway
pcw04723  Retrograde endocannabinoid signaling
pcw04724  Glutamatergic synapse
pcw04725  Cholinergic synapse
pcw04726  Serotonergic synapse
pcw04730  Long-term depression
pcw04810  Regulation of actin cytoskeleton
pcw04910  Insulin signaling pathway
pcw04912  GnRH signaling pathway
pcw04914  Progesterone-mediated oocyte maturation
pcw04915  Estrogen signaling pathway
pcw04916  Melanogenesis
pcw04917  Prolactin signaling pathway
pcw04919  Thyroid hormone signaling pathway
pcw04921  Oxytocin signaling pathway
pcw04926  Relaxin signaling pathway
pcw04928  Parathyroid hormone synthesis, secretion and action
pcw04929  GnRH secretion
pcw04930  Type II diabetes mellitus
pcw04933  AGE-RAGE signaling pathway in diabetic complications
pcw04934  Cushing syndrome
pcw04935  Growth hormone synthesis, secretion and action
pcw04960  Aldosterone-regulated sodium reabsorption
pcw05010  Alzheimer disease
pcw05020  Prion disease
pcw05022  Pathways of neurodegeneration - multiple diseases
pcw05034  Alcoholism
pcw05132  Salmonella infection
pcw05133  Pertussis
pcw05135  Yersinia infection
pcw05140  Leishmaniasis
pcw05142  Chagas disease
pcw05145  Toxoplasmosis
pcw05152  Tuberculosis
pcw05160  Hepatitis C
pcw05161  Hepatitis B
pcw05163  Human cytomegalovirus infection
pcw05164  Influenza A
pcw05165  Human papillomavirus infection
pcw05166  Human T-cell leukemia virus 1 infection
pcw05167  Kaposi sarcoma-associated herpesvirus infection
pcw05170  Human immunodeficiency virus 1 infection
pcw05171  Coronavirus disease - COVID-19
pcw05200  Pathways in cancer
pcw05203  Viral carcinogenesis
pcw05205  Proteoglycans in cancer
pcw05206  MicroRNAs in cancer
pcw05207  Chemical carcinogenesis - receptor activation
pcw05208  Chemical carcinogenesis - reactive oxygen species
pcw05210  Colorectal cancer
pcw05211  Renal cell carcinoma
pcw05212  Pancreatic cancer
pcw05213  Endometrial cancer
pcw05214  Glioma
pcw05215  Prostate cancer
pcw05216  Thyroid cancer
pcw05218  Melanoma
pcw05219  Bladder cancer
pcw05220  Chronic myeloid leukemia
pcw05221  Acute myeloid leukemia
pcw05223  Non-small cell lung cancer
pcw05224  Breast cancer
pcw05225  Hepatocellular carcinoma
pcw05226  Gastric cancer
pcw05230  Central carbon metabolism in cancer
pcw05231  Choline metabolism in cancer
pcw05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pcw05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110221918 (MAPK3)
   04012 ErbB signaling pathway
    110221918 (MAPK3)
   04014 Ras signaling pathway
    110221918 (MAPK3)
   04015 Rap1 signaling pathway
    110221918 (MAPK3)
   04350 TGF-beta signaling pathway
    110221918 (MAPK3)
   04370 VEGF signaling pathway
    110221918 (MAPK3)
   04371 Apelin signaling pathway
    110221918 (MAPK3)
   04668 TNF signaling pathway
    110221918 (MAPK3)
   04066 HIF-1 signaling pathway
    110221918 (MAPK3)
   04068 FoxO signaling pathway
    110221918 (MAPK3)
   04072 Phospholipase D signaling pathway
    110221918 (MAPK3)
   04071 Sphingolipid signaling pathway
    110221918 (MAPK3)
   04024 cAMP signaling pathway
    110221918 (MAPK3)
   04022 cGMP-PKG signaling pathway
    110221918 (MAPK3)
   04151 PI3K-Akt signaling pathway
    110221918 (MAPK3)
   04150 mTOR signaling pathway
    110221918 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110221918 (MAPK3)
   04148 Efferocytosis
    110221918 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    110221918 (MAPK3)
   04210 Apoptosis
    110221918 (MAPK3)
   04218 Cellular senescence
    110221918 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110221918 (MAPK3)
   04520 Adherens junction
    110221918 (MAPK3)
   04540 Gap junction
    110221918 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110221918 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110221918 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110221918 (MAPK3)
   04613 Neutrophil extracellular trap formation
    110221918 (MAPK3)
   04620 Toll-like receptor signaling pathway
    110221918 (MAPK3)
   04621 NOD-like receptor signaling pathway
    110221918 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    110221918 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    110221918 (MAPK3)
   04660 T cell receptor signaling pathway
    110221918 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    110221918 (MAPK3)
   04659 Th17 cell differentiation
    110221918 (MAPK3)
   04657 IL-17 signaling pathway
    110221918 (MAPK3)
   04662 B cell receptor signaling pathway
    110221918 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    110221918 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    110221918 (MAPK3)
   04062 Chemokine signaling pathway
    110221918 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110221918 (MAPK3)
   04929 GnRH secretion
    110221918 (MAPK3)
   04912 GnRH signaling pathway
    110221918 (MAPK3)
   04915 Estrogen signaling pathway
    110221918 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    110221918 (MAPK3)
   04917 Prolactin signaling pathway
    110221918 (MAPK3)
   04921 Oxytocin signaling pathway
    110221918 (MAPK3)
   04926 Relaxin signaling pathway
    110221918 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    110221918 (MAPK3)
   04919 Thyroid hormone signaling pathway
    110221918 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    110221918 (MAPK3)
   04916 Melanogenesis
    110221918 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110221918 (MAPK3)
   04270 Vascular smooth muscle contraction
    110221918 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110221918 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    110221918 (MAPK3)
   04725 Cholinergic synapse
    110221918 (MAPK3)
   04726 Serotonergic synapse
    110221918 (MAPK3)
   04720 Long-term potentiation
    110221918 (MAPK3)
   04730 Long-term depression
    110221918 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    110221918 (MAPK3)
   04722 Neurotrophin signaling pathway
    110221918 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    110221918 (MAPK3)
   04380 Osteoclast differentiation
    110221918 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110221918 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110221918 (MAPK3)
   05206 MicroRNAs in cancer
    110221918 (MAPK3)
   05205 Proteoglycans in cancer
    110221918 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    110221918 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    110221918 (MAPK3)
   05203 Viral carcinogenesis
    110221918 (MAPK3)
   05230 Central carbon metabolism in cancer
    110221918 (MAPK3)
   05231 Choline metabolism in cancer
    110221918 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110221918 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110221918 (MAPK3)
   05212 Pancreatic cancer
    110221918 (MAPK3)
   05225 Hepatocellular carcinoma
    110221918 (MAPK3)
   05226 Gastric cancer
    110221918 (MAPK3)
   05214 Glioma
    110221918 (MAPK3)
   05216 Thyroid cancer
    110221918 (MAPK3)
   05221 Acute myeloid leukemia
    110221918 (MAPK3)
   05220 Chronic myeloid leukemia
    110221918 (MAPK3)
   05218 Melanoma
    110221918 (MAPK3)
   05211 Renal cell carcinoma
    110221918 (MAPK3)
   05219 Bladder cancer
    110221918 (MAPK3)
   05215 Prostate cancer
    110221918 (MAPK3)
   05213 Endometrial cancer
    110221918 (MAPK3)
   05224 Breast cancer
    110221918 (MAPK3)
   05223 Non-small cell lung cancer
    110221918 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110221918 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    110221918 (MAPK3)
   05161 Hepatitis B
    110221918 (MAPK3)
   05160 Hepatitis C
    110221918 (MAPK3)
   05171 Coronavirus disease - COVID-19
    110221918 (MAPK3)
   05164 Influenza A
    110221918 (MAPK3)
   05163 Human cytomegalovirus infection
    110221918 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110221918 (MAPK3)
   05165 Human papillomavirus infection
    110221918 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110221918 (MAPK3)
   05135 Yersinia infection
    110221918 (MAPK3)
   05133 Pertussis
    110221918 (MAPK3)
   05152 Tuberculosis
    110221918 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110221918 (MAPK3)
   05140 Leishmaniasis
    110221918 (MAPK3)
   05142 Chagas disease
    110221918 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110221918 (MAPK3)
   05020 Prion disease
    110221918 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    110221918 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    110221918 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110221918 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110221918 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110221918 (MAPK3)
   04934 Cushing syndrome
    110221918 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110221918 (MAPK3)
   01524 Platinum drug resistance
    110221918 (MAPK3)
   01522 Endocrine resistance
    110221918 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcw01001]
    110221918 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcw03036]
    110221918 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcw04147]
    110221918 (MAPK3)
Enzymes [BR:pcw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110221918 (MAPK3)
Protein kinases [BR:pcw01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110221918 (MAPK3)
Chromosome and associated proteins [BR:pcw03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110221918 (MAPK3)
Exosome [BR:pcw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110221918 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 110221918
NCBI-ProteinID: XP_020862297
UniProt: A0A6P5LUX1
LinkDB
Position
Unknown
AA seq 380 aa
MAAAVAAEGGGGGEPQGVDGSGPGVPGKVEMVKGQPFDVGPRYTELQYIGEGAYGMVSSA
FDHVRKARVAIKKISPFEHQTYCQRTLREIQILLRCHHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQDDLNCIINMKARNYLQSLPSKPKVPWVKLFPKA
DPKALDLLDRMLTFNPNKRITVEDALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGAPGAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggtggcggctgaggggggagggggcggggagccccagggagttgacggg
tccggtccgggggtcccgggtaaggtggagatggtaaagggccagccgtttgacgtggga
ccgcgctacacagagctgcagtacattggggagggggcgtacggcatggtcagctctgcc
tttgaccatgtgcggaaggcccgagtagccatcaaaaagatcagcccatttgagcaccag
acatattgccagcgcactctacgggagattcagatcctgcttcgttgccaccatgaaaat
gtcattggcatccgtgacatccttcgagcacccacgctggaggccatgagggatgtctat
attgttcaggacctgatggaaacagacttgtataagctgctcaagagccagcagctgagt
aatgaccatgtctgctacttcctgtaccaaatcctaagaggcctcaaatatatccactcg
gccaatgtgctccatcgggatctcaaaccctccaacctgctcattaacaccacttgtgac
ctcaagatctgtgactttggcctggcccgaattgctgaccctgagcatgatcacacaggc
tttctgacagagtatgtggctacccgatggtacagagcaccagagatcatgctcaattcc
aagggctataccaagtccatcgatatctggtctgtgggctgtatcctcgcagaaatgctc
tccaatcgacccatcttccctgggaagcactacctggaccagctgaaccacattctaggt
atcctgggttctccatcccaggatgatttgaactgtatcatcaacatgaaggctcggaac
tacctgcagtcccttccatccaagcctaaggtgccctgggtcaagctgtttcccaaagca
gaccccaaagccctggacttgctggaccggatgttgacctttaatcccaacaagcgaatc
acggtggaggatgccctggcccatccctatttggaacagtactatgatccaactgatgag
ccggtggcagaagaaccctttacctttgacatggagctggatgacctgccaaaggaacgg
ctgaaggagctcatcttccaagagacagcccgattccagcctggagccccaggagccccc
tga

DBGET integrated database retrieval system