Phascolarctos cinereus (koala): 4108306 Help Entry 4108306           CDS       T05867                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pcw  Phascolarctos cinereus (koala) Pathway pcw00190   Oxidative phosphorylation pcw01100   Metabolic pathways pcw04714   Thermogenesis pcw04723   Retrograde endocannabinoid signaling pcw05010   Alzheimer disease pcw05012   Parkinson disease pcw05014   Amyotrophic lateral sclerosis pcw05016   Huntington disease pcw05020   Prion disease pcw05022   Pathways of neurodegeneration - multiple diseases pcw05208   Chemical carcinogenesis - reactive oxygen species pcw05415   Diabetic cardiomyopathy Module pcw_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pcw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     4108306 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     4108306 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     4108306 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     4108306 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     4108306 (ND4L)    05012 Parkinson disease     4108306 (ND4L)    05014 Amyotrophic lateral sclerosis     4108306 (ND4L)    05016 Huntington disease     4108306 (ND4L)    05020 Prion disease     4108306 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     4108306 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     4108306 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pcw03029]     4108306 (ND4L) Enzymes [BR:pcw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      4108306 (ND4L) Mitochondrial biogenesis [BR:pcw03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     4108306 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 SpoIIM Motif Other DBs NCBI-GeneID:  4108306 NCBI-ProteinID:  YP_637018 UniProt:  Q1MWJ1 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MTSINLNLMTAFLLALAGVLMYRSHLMSTLLCLEGMMLSLYIMLSLLISHFHMFSLSMAP LILLVISACEAAGGLALLVKMSNNYGNDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacctcaatcaacttaaacctaataacagcctttttactagccctagcaggagtccta atatatcgatcccacctaatatcaactctactatgcttagaaggtataatactatcacta tatattatattatccctcctaatttcccacttccacatattctccttatcaatagcacca ctaatcctactagtaatctcagcatgtgaagcagctggaggattagcattattagtaaaa atatctaacaactatggcaacgactatgtacaaaacctaaatctcctacaatgctaa

DBGET integrated database retrieval system