Plasmodium cynomolgi: PCYB_032570 Help Entry PCYB_032570       CDS       T02490                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism pcy  Plasmodium cynomolgi Pathway pcy03050   Proteasome pcy03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pcy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     PCYB_032570   09124 Replication and repair    03440 Homologous recombination     PCYB_032570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pcy03019]     PCYB_032570    04131 Membrane trafficking [BR:pcy04131]     PCYB_032570    03051 Proteasome [BR:pcy03051]     PCYB_032570    03400 DNA repair and recombination proteins [BR:pcy03400]     PCYB_032570 Messenger RNA biogenesis [BR:pcy03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      PCYB_032570 Membrane trafficking [BR:pcy04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     PCYB_032570 Proteasome [BR:pcy03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      PCYB_032570 DNA repair and recombination proteins [BR:pcy03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      PCYB_032570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Vasculin Motif Other DBs NCBI-GeneID:  14691371 NCBI-ProteinID:  XP_004220977 UniProt:  K6UCH2 LinkDB All DBs Position 3:742047..742710 Genome browser AA seq 107 aa AA seqDB search MQKNTPESGNVNDPMKDMKDGKADVKPNDLNDDNIYIFDEPDDELEEFEEMGSTAHNIDT DLENWEEDWGAAGWDDDDDDDDKFILKVESELQNFKATLDAERDLKK NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcaaaagaacactccggaaagcgggaacgtaaatgacccgatgaaagatatgaaggac ggcaaggcggacgtgaaaccgaacgacctcaacgatgacaacatatatattttcgatgag ccggatgatgagctggaggagttcgaggagatgggcagcacagcccacaacatagacacc gatctggaaaattgggaagaagactggggagcagcgggatgggatgatgacgacgacgat gatgataaatttattttgaaggtggagtctgaactgcagaacttcaaagccactttggat gccgaaagggatttgaagaaatga

DBGET integrated database retrieval system