Plasmodium cynomolgi: PCYB_061440 Help Entry PCYB_061440       CDS       T02490                                  Name (RefSeq) roadblock/LC7 family member   KO K10419   dynein light chain roadblock-type Organism pcy  Plasmodium cynomolgi Pathway pcy04814   Motor proteins Brite KEGG Orthology (KO) [BR:pcy00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PCYB_061440  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcy04131]     PCYB_061440   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pcy03037]     PCYB_061440    04812 Cytoskeleton proteins [BR:pcy04812]     PCYB_061440 Membrane trafficking [BR:pcy04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     PCYB_061440 Cilium and associated proteins [BR:pcy03037]  Motile cilia and associated proteins   Dynein arm    PCYB_061440 Cytoskeleton proteins [BR:pcy04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PCYB_061440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Robl_LC7 LAMTOR5 CHASE8 Diacid_rec Motif Other DBs NCBI-GeneID:  14691883 NCBI-ProteinID:  XP_004221359 UniProt:  K6V8D6 LinkDB All DBs Position 6:complement(201362..201896) Genome browser AA seq 99 aa AA seqDB search SEAEEILNRIKSHKGVVGILVVNREGLIIKSTFDQQQSDLHASLLTQLSNKARDVIRELD PQNDITFLRLRSKKHEIMIAPDKDYTLVVVQDPYADREK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt agcgaggcggaagaaatcctaaacaggataaagagtcacaagggggttgttggcatcctg gtggtcaacagggaggggttaataataaaaagtaccttcgatcagcagcagtcggatctg cacgcgtccctgctgacgcagctttcgaataaggcccgggatgtcattagggagttggat ccccagaacgacatcaccttcctgcgcttgcgatcgaagaagcacgaaataatgatcgct ccggacaaagattacacgttggtggtggttcaggacccatacgccgaccgggaaaagtag

DBGET integrated database retrieval system