KEGG   Plasmodium cynomolgi: PCYB_072300
Entry
PCYB_072300       CDS       T02490                                 
Name
(RefSeq) 6-phosphofructokinase
  KO
K24182  6-phosphofructokinase [EC:2.7.1.11]
Organism
pcy  Plasmodium cynomolgi
Pathway
pcy00010  Glycolysis / Gluconeogenesis
pcy00030  Pentose phosphate pathway
pcy00051  Fructose and mannose metabolism
pcy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCYB_072300
   00030 Pentose phosphate pathway
    PCYB_072300
   00051 Fructose and mannose metabolism
    PCYB_072300
Enzymes [BR:pcy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PCYB_072300
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 14692076
NCBI-ProteinID: XP_004221675
UniProt: K6UJ97
LinkDB
Position
7:complement(609997..614316)
AA seq 1439 aa
MRNFNDNAGEAKKPSMEGLVKTMSVLLRDNECAFNLEEHEEQEDQRSTDQRSLDKKDSEM
IDCLMQKLTSKKFLLEKETKNTFFLVDNDNMKIKKLKEHGHSASLNDDLSPLQYERIKYQ
PTLPKALASEYQVLEENHGDDFINKKDYEEIKKYLKNLHNLPILNVKETNNHESFKGGNV
LKIGIILSGGPAPGGHNVISGIYDYAKRYNEQSQVIGFLGGIDGLYSKNYVTVTDSLMNR
FRNLGGFNMLWSGRGKVRNKDDLIAIENIVTKLKMNGLVIIGGDGSNSNAALISEYFAER
KIPISIIGIPKTIDGDLKSEAIEISFGFDTATKTYSEVIGNLCTDVKTGHNVYHVVRVMG
RSASHVVLECALQTRPNIVLIGEEVEKEKLSLKDIVSNIVNTILKRRSLNKNYGVILIPE
GLIEFVPEMKVLIGELNVILKEGPFDADKLKHSREVWDFLPTIIQDQLLMDRESTGYIQV
GKIATERLIIVLVESELAKLNDSSLNIQFMAHYLGYEGRCAIPSNFDCNYCYALGYNAAL
LIDHKKTGYMSIIQNLEDSYANWIPAAIPFLRIMHVNRDNTGKEFPAVKRYLVDLNSPLF
NVLKQVRNLWSLYDLYRSPGPIQFNGHLSNSRCYTVKIPTKDLLLCQNSEDLQLIISLTN
KTNHVGDNITGGSEEEGGSQKDLSGISSADSQKGNELGSVSATSKGAHENFLLSTHSEEV
GHDSGGVAGKKTTLPDMAIEASANADNVENDFYEQHCSSYKSLGCMSELQTSRLYNKLEL
PELCSDLKAKVRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFHDKYATPISFEIK
IGIVFLSRQAPGAMNVLCGLYHRLKLLKGVCIAFYGLYGLLNNKYIIIDDDNIAKHLNQG
GLELTGNSPEHSLFDKENRNKVCETVTNLQLNGLVMPGSNVTITEAALLAEYFLEKKIPT
SVVGIPLTGSNNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKYWHFIRLMGRSPS
HEVLECALQTHPNMVIISEEYGAADKTLWRVVQDIADVVCARAELGKNYGTILIPDALLM
HLPHMKILLTEISDILNDANEKGQLAEARNDLVNLSTMKSGTAGGGAASGGGAASGAASV
GGAASGAPSGAEQPLSGSPWVLKLTPWSLALLKTFPQFIIKELLHVDLRSMRFEKLETEQ
LLLQMVKEELHQRKEKGKYSGIFMGLTHFFGYQGRSSLPSEFDCKLAYSYGHAASIVIES
GLTGYIVSIRGLCGNIKDWKMFAIPFISLMKILPRGQGSKYLKSASKGDLPVIPSAPVDL
NGKAYRSLKVALQKWQMEDRFCNPGPIQFEGNASNYYNRILFEEQSEYFEMLRYVECYAN
ILKDTCRFGVSADYLKNVFVQLCGMLVLAYKPNDILSNMPCIGSIEDYYDWENQRKRMD
NT seq 4320 nt   +upstreamnt  +downstreamnt
atgagaaactttaacgataacgccggagaggcgaagaagccatccatggaaggtctcgtc
aaaaccatgtctgtgctgctaagggacaacgaatgcgctttcaatttggaagaacacgaa
gagcaggaagaccaacgaagcacagaccaaagatcgttggacaaaaaagacagtgagatg
attgactgtttgatgcaaaagctaacgtcgaaaaagttcctgttggagaaggaaacgaag
aacaccttctttcttgtagataacgataatatgaagataaaaaagctaaaggaacatggc
cactcggcatccctaaatgatgatttgagtcctctacagtatgaaaggataaagtaccaa
cctacattacccaaggcgctggcaagtgagtaccaggtgttggaagaaaaccatggggat
gattttattaacaaaaaagattatgaggagattaaaaaatatttgaaaaatctacataac
ttgcccattttgaatgtgaaggaaacgaataaccatgaatctttcaaaggaggaaatgta
ttgaaaattggaattattttatctggtggtcctgcaccaggtggacacaacgtcatatcg
ggtatatatgactatgccaagaggtacaacgagcagtcgcaagttattggcttcttagga
gggatagatggcttgtatagcaaaaattatgtcaccgttacggattctttgatgaatcga
tttcgcaacttgggagggtttaacatgctgtggtcaggacgagggaaggtaagaaataaa
gacgatttaattgctatagaaaatattgttacaaagttgaaaatgaatggtttggtaata
atcggaggggatggatccaacagtaacgcagcattgatatctgaatatttcgctgagagg
aaaatcccaatttctattatcggcattccgaagaccatcgatggggatttaaaaagtgaa
gcaatagaaattagctttggcttcgatacagccacgaagacgtactcagaagtgataggc
aatctatgcacagatgtgaagacaggacataatgtatatcacgtggtgagagtgatggga
aggtcagcttcccatgtagtattggagtgtgctctgcagaccaggccgaacatagtcctc
ataggggaagaagtagagaaggagaagctatccctaaaggatatcgtgagcaatattgtt
aatactatattgaagagaaggtcactaaataaaaactacggagttattttaattccagaa
ggactgatcgaatttgtacccgaaatgaaggttctaattggtgaattaaatgtcatattg
aaagaaggtccatttgatgcagacaaattgaagcactcaagagaggtatgggatttctta
cccactattattcaggaccagcttttaatggatagggaatctactggatatattcaagtg
gggaaaattgcaacagagaggttaatcattgtacttgtcgaatctgagctagccaaactg
aatgacagtagtttgaatattcagtttatggctcactatttaggatacgagggcagatgt
gctatcccgtccaactttgactgtaactattgctatgccttggggtataacgcagctttg
ctaattgatcataagaaaacagggtacatgtctatcatacagaatttggaagattcctat
gcgaattggatccctgcggccattccgtttctacgtatcatgcatgtgaatagggacaac
acagggaaagagttcccagctgtgaagagatacctcgtagatttgaatagcccacttttc
aacgtattgaaacaagttcgtaatttgtggtccctctacgatctgtatagatctccaggt
ccgattcagttcaacgggcacttgagtaactccagatgctacacggtgaagatacccacg
aaggatttactcctgtgtcagaactcggaagacttgcagttgattatcagtttgactaat
aagacgaaccatgtgggggataatatcactggtggttcggaagaggaggggggtagtcag
aaggatttgagtggcatctcctccgccgattcgcagaaggggaacgaacttggttcagtt
agtgccacatctaaaggggctcacgaaaatttcctattatccacgcatagtgaagaagtg
ggacatgactcaggaggggtcgcagggaagaagaccaccctccctgatatggcaatcgaa
gcaagtgccaacgcggataatgtggaaaacgacttttacgaacagcactgctctagttac
aagtccttaggatgcatgtccgagttgcagacctcgaggctgtacaacaagctggaactc
cctgaactgtgctcagatttgaaggccaaagtgagagcaggaaaacagtacatatcgaat
gacccctacactcagaagcagatcctgtccaattatccccacatgtcttatgaaaataaa
tttcaaattcaggaaatttttcacgacaagtatgccacaccgatatcgtttgaaataaag
ataggaattgtgtttctgtctagacaggcacccggggcgatgaatgtgttatgtggtctc
taccacagattgaagctgctaaagggggtatgcattgccttttacggattgtatggcctg
ttaaacaataagtatatcattatagacgatgacaacatagcgaagcatttgaaccaggga
gggttggagttaacgggtaattccccggaacactctctatttgataaagagaacagaaat
aaggtttgcgagacagtcaccaatttgcagctaaacggtttggtgatgcctggatcgaat
gtcaccattacggaagcggctctccttgcggagtatttcctggagaagaagatccctact
tccgttgtgggtattccgttaactggctcgaacaacttgattcacgagttgatagagaca
tgtgtaggttttgacagcagcacgaaggtgtatgcctctcttattggaaatgtccttaca
gatgcagtgagtatgcctaagtattggcatttcattcggctgatgggaagatctccttcg
catgaagtcctggagtgcgcgctgcagactcatccgaacatggtgataatctctgaggag
tatggagcagcagataaaacactgtggagggttgtgcaagacattgcagacgttgtttgt
gcaagggctgaactgggaaagaactacgggacgatattaatccctgatgcgctgctcatg
catctaccccatatgaagattttactgacggaaattagtgacatactgaacgatgccaat
gagaaggggcagttggctgaggcgagaaacgacttggtcaatttgtccacaatgaagagt
ggcacagcggggggaggggcagcatcaggggggggagcagcgtccggggcagcatcagtt
ggaggagcagcgtccggggcaccgtccggggcggagcaacccctgtctggctccccgtgg
gtccttaaattgaccccgtggagcttagccctgctgaagaccttcccccagttcatcatc
aaagaactactacacgtggatctgagatctatgagatttgagaagttagagacagagcag
ttgcttcttcaaatggtaaaggaggaactccatcagagaaaagaaaaaggaaaatattca
ggaatcttcatgggattgacccatttctttggctaccaaggtcgttcatcattgccatcc
gaatttgattgtaagttggcatattcctacgggcatgctgcttccatagtgattgaaagt
ggacttacaggatatatcgtctcgattaggggtctctgtggaaacataaaagattggaaa
atgtttgcaattccttttatatctttgatgaaaattttgcctaggggacagggcagtaag
tatttgaagagcgcctccaagggggacctgcctgtcattcctagtgccccggttgacctg
aacggcaaggcgtatagaagcttaaaggttgcgttgcagaagtggcagatggaggatagg
ttttgtaatcccggacccattcagtttgaaggaaatgcgtctaactattacaaccgcatt
ttgtttgaagagcagtctgagtacttcgagatgctgcgctatgtggagtgctacgcgaac
atactgaaggatacgtgccgtttcggagtctcagccgattaccttaagaacgtgttcgtg
cagctgtgcggcatgcttgttctcgcgtacaagccgaacgacattctctcgaacatgccc
tgcatcggcagcatcgaggattactacgactgggagaaccagcgcaagcggatggactag

DBGET integrated database retrieval system