Pseudomonas chlororaphis PCL1606: PCL1606_36280 Help Entry PCL1606_36280     CDS       T03768                                  Name (GenBank) (2Fe-2S)-binding protein   KO K10814   hydrogen cyanide synthase HcnA [EC:1.4.99.5] Organism pcz  Pseudomonas chlororaphis PCL1606 Pathway pcz00460   Cyanoamino acid metabolism pcz01100   Metabolic pathways pcz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pcz00001]  09100 Metabolism   09106 Metabolism of other amino acids    00460 Cyanoamino acid metabolism     PCL1606_36280  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02042 Bacterial toxins [BR:pcz02042]     PCL1606_36280 Enzymes [BR:pcz01000]  1. Oxidoreductases   1.4  Acting on the CH-NH2 group of donors    1.4.99  With unknown physiological acceptors     1.4.99.5  glycine dehydrogenase (cyanide-forming)      PCL1606_36280 Bacterial toxins [BR:pcz02042]  Not specified   Hydrogen cyanide production    PCL1606_36280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer2_4 Fer2_3 Fer2 DHODB_Fe-S_bind Motif Other DBs NCBI-ProteinID:  AKA25079 UniProt:  A0A0D5Y273 LinkDB All DBs Position complement(3974059..3974376) Genome browser AA seq 105 aa AA seqDB search MRQTERTFDIQPLQRADMTISLNGQPVTAAIGETVLSVIQSLGLRQVARNDHGQLAGAYC GMGVCHCCLVQIDGRHKRRACQTQVRPGMQVQTEVNRIVATEDTP NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcgccagaccgaacgaaccttcgatatccagccgttgcaacgggcggatatgaccatc agcctcaatggccagccggtgacggcggcgatcggcgaaaccgtgctcagcgtcatccag tccctggggctgcgccaggtggcgcgcaacgaccacggccagctggccggcgcctattgc ggcatgggcgtgtgccactgctgcctggtgcagatcgacggccgccacaagcgccgtgcc tgccagacccaggtgcgtccgggcatgcaggtgcagaccgaagtcaaccgcatcgtcgcg acggaggacacgccatga

DBGET integrated database retrieval system