Phoenix dactylifera (date palm): 103705809 Help Entry 103705809         CDS       T03274                                  Name (RefSeq) calmodulin-like isoform X1   KO K02183   calmodulin Organism pda  Phoenix dactylifera (date palm) Pathway pda04016   MAPK signaling pathway - plant pda04070   Phosphatidylinositol signaling system pda04075   Plant hormone signal transduction pda04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pda00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     103705809    04070 Phosphatidylinositol signaling system     103705809    04075 Plant hormone signal transduction     103705809  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     103705809  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pda01009]     103705809   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pda04131]     103705809    03036 Chromosome and associated proteins [BR:pda03036]     103705809   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pda04147]     103705809 Protein phosphatases and associated proteins [BR:pda01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103705809 Membrane trafficking [BR:pda04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103705809 Chromosome and associated proteins [BR:pda03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103705809 Exosome [BR:pda04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103705809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C Dockerin_1 SPARC_Ca_bdg EF-hand_11 EFhand_Ca_insen UPF0154 RNA_pol_Rpb4 SPEF2_C DUF5580_M PA_Ig-like Motif Other DBs NCBI-GeneID:  103705809 NCBI-ProteinID:  XP_008787894 UniProt:  A0A8B7BY96 LinkDB All DBs Position 15:complement(9730606..9737654) Genome browser AA seq 149 aa AA seqDB search MAQHLTEEQIAEFKALFGLFDKDGDGCITTKELSIVMRSLGQNPTEAELQDMINEVDADQ NGAIDFPEFLNLMACKMKNTDSEEELKEAFKVFDKDRNGFISATDLRNVLTNLGEKLTDE EANEMIREADIDGDGQVNYEEFVIMMLAR NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcgcagcatctgacggaggagcagatcgcggagttcaaggcgctcttcggcctcttc gacaaggacggagacggctgcataactaccaaagaactgagcattgtgatgagatccttg ggacagaatccaactgaagctgaactgcaggatatgatcaatgaagttgatgctgatcaa aatggagccattgattttcctgagtttttgaatttgatggcatgcaaaatgaaaaacact gattctgaggaagaactgaaggaagcattcaaagtgtttgacaaggatcggaacggtttt atatctgctacagatctccgtaatgtgttgacaaaccttggagagaagctgacagatgag gaagctaacgagatgatacgagaagcggatattgatggtgacgggcaagtgaactacgag gagtttgtgataatgatgttggccaggtga

DBGET integrated database retrieval system