Phoenix dactylifera (date palm): 103708417 Help Entry 103708417         CDS       T03274                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism pda  Phoenix dactylifera (date palm) Brite KEGG Orthology (KO) [BR:pda00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:pda03041]     103708417   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pda04052]     103708417 Spliceosome [BR:pda03041]  Complex B   Other components    Complex B specific factors     103708417 Cytokines and neuropeptides [BR:pda04052]  Neuropeptides   Unclassified    103708417 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler MxiM Motif Other DBs NCBI-GeneID:  103708417 NCBI-ProteinID:  XP_008791553 UniProt:  A0A8B7C4H0 LinkDB All DBs Position 2:444449..454657 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYTMYKDHITLRDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgctgaacgatcggctggggaagaaggtgcgggtgaagtgcaacgag gatgacacgatcggcgatctcaagaagctggtggcggcgcagacggggacgagggccgac aagatccgcatccagaagtggtacaccatgtacaaggaccacatcaccctccgcgattac gagatccacgacggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system