Phoenix dactylifera (date palm): 103719242 Help Entry 103719242         CDS       T03274                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pda  Phoenix dactylifera (date palm) Pathway pda04145   Phagosome pda04148   Efferocytosis pda04517   IgSF CAM signaling pda04518   Integrin signaling pda04620   Toll-like receptor signaling pathway pda05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pda00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103719242    04518 Integrin signaling     103719242  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103719242    04148 Efferocytosis     103719242  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103719242  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103719242  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pda04131]     103719242   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pda04147]     103719242    04031 GTP-binding proteins [BR:pda04031]     103719242 Membrane trafficking [BR:pda04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103719242  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103719242   Macropinocytosis    Ras GTPases     103719242  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     103719242 Exosome [BR:pda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103719242   Exosomal proteins of other body fluids (saliva and urine)    103719242   Exosomal proteins of colorectal cancer cells    103719242   Exosomal proteins of bladder cancer cells    103719242 GTP-binding proteins [BR:pda04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103719242 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  103719242 NCBI-ProteinID:  XP_008806609 UniProt:  A0A8B7CUU9 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKRKGQKVCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggttcataaagtgcgtcactgtgggggacggcgccgtcggcaagacc tgcatgcttatatcctataccagcaacaccttccccacggattatgttccaacagttttt gacaatttcagtgcaaatgtcgtggtcgatggtagcactgttaacctaggtttgtgggat actgcaggccaggaggactacaatagattaagacctttgagctatcgtggggctgatgtt tttttacttgcattctctctcatcagtaaggccagctatgaaaatgttgccaagaagtgg attcctgaattgaggcactatgcacctggtgtgcctataattcttgttggaacgaagctt gatcttcgggatgacaagcagttttttatagatcacccaggtgccgtccccattactact gctcagggagaagagctgaggaaggcaattggagctcctgcctacatcgagtgcagttcg aagacccaacaaaacgtcaaggcagtttttgatgcagccattaaggtagtactccagcct cccaagcagaagaagaagaagaggaagggacagaaggtctgctccattttgtga

DBGET integrated database retrieval system