Phoenix dactylifera (date palm): 103724128 Help Entry 103724128         CDS       T03274                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pda  Phoenix dactylifera (date palm) Pathway pda04145   Phagosome pda04148   Efferocytosis pda04517   IgSF CAM signaling pda04518   Integrin signaling pda04620   Toll-like receptor signaling pathway pda05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pda00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103724128    04518 Integrin signaling     103724128  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103724128    04148 Efferocytosis     103724128  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103724128  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103724128  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pda04131]     103724128   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pda04147]     103724128    04031 GTP-binding proteins [BR:pda04031]     103724128 Membrane trafficking [BR:pda04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103724128  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103724128   Macropinocytosis    Ras GTPases     103724128  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     103724128 Exosome [BR:pda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103724128   Exosomal proteins of other body fluids (saliva and urine)    103724128   Exosomal proteins of colorectal cancer cells    103724128   Exosomal proteins of bladder cancer cells    103724128 GTP-binding proteins [BR:pda04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103724128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  103724128 NCBI-ProteinID:  XP_008813511 UniProt:  A0A8B7D5C4 LinkDB All DBs Position 2:4287013..4303766 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQYFMDHPGAVPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRKAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggtttataaagtgcgttacggtcggggacggcgccgtcggcaagacc tgcatgctgatttcctacacgagcaacacattccccacggactatgtcccaactgttttt gacaacttcagtgcgaacgtggtggtagatgggaacactgtgaacctagggttgtgggac actgcaggccaggaggattacaatagactaagacctttgagctatcgtggagctgatgtt tttctcctagccttctccctcatcagtaaggccagctacgaaaatgttgctaaaaagtgg attcctgaattgaggcattatgcgcctggtgttcctataattcttgttggaacaaagctt gatcttcgggatgataagcagtacttcatggatcatcctggtgctgtgcctattaccact gctcagggagaagagctgaggaagctaataggtgctcctatctatatcgagtgcagttca aagacacagcaaaatgttaaggcagtcttcgatgcagccattaaagttgtacttcagccc cctaagcaaaagaagaagaagaagagaaaggcacagaaggcctgttccattttgtga

DBGET integrated database retrieval system