Phoenix dactylifera (date palm): 11542558 Help Entry 11542558          CDS       T03274                                  Symbol nad4L, KEH32_p30 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pda  Phoenix dactylifera (date palm) Pathway pda00190   Oxidative phosphorylation pda01100   Metabolic pathways Module pda_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pda00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     11542558 (nad4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pda03029]     11542558 (nad4L) Enzymes [BR:pda01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      11542558 (nad4L) Mitochondrial biogenesis [BR:pda03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     11542558 (nad4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  11542558 NCBI-ProteinID:  YP_005090376 UniProt:  G9HNT6 LinkDB All DBs Position MT:complement(249264..249566) Genome browser AA seq 100 aa AA seqDB search MDPIKYFTFSMIISILGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSLDDMMGQL FALLVLTVAAAESAIGSAIFVNTFRVRGTIAVESINCIQG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt acggatcctatcaaatatttcacattttctatgatcatctctattttaggtattcgggga atcctccttaatagacgaaatattcctattatgtcaatgccaattgaatcaatgttatta gctgtcaattcgaactttttggtattttccgtttctttggatgatatgatgggtcaatta tttgctttattagttctaacagtggcagctgcggaatctgctattggatcagccattttc gttaacacttttcgagtccgagggactattgcagtcgaatccataaattgcattcaaggt taa

DBGET integrated database retrieval system