Pasteurella dagmatis: 4362423_01546 Help Entry 4362423_01546     CDS       T05467                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdag  Pasteurella dagmatis Pathway pdag01100   Metabolic pathways pdag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     4362423_01546    00074 Mycolic acid biosynthesis     4362423_01546   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     4362423_01546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  SNV77966 LinkDB All DBs Position 1:1668536..1668796 Genome browser AA seq 86 aa AA seqDB search MQTLENEIKQLIIDSLNLEDLSIDEIETEMPLFNEGLGLDSIDALELGLAIKNKFKVQLN AENEEVHQHFYSVKTLADFIRSQYEV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttgcaaacattagaaaatgaaatcaaacaactgattattgattctctgaatttagaagat ctttcaattgatgagattgaaacagaaatgccattatttaatgagggattaggattagat tccattgatgccttagagcttggattggctattaaaaataaatttaaagtacaacttaac gctgaaaatgaagaagtacatcagcatttctactcggtaaaaacattagcggattttatt cgctcacaatacgaggtataa

DBGET integrated database retrieval system