Pasteurella dagmatis: 4362423_01547 Help Entry 4362423_01547     CDS       T05467                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism pdag  Pasteurella dagmatis Pathway pdag01100   Metabolic pathways pdag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     4362423_01547 (acpP_2)    00074 Mycolic acid biosynthesis     4362423_01547 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     4362423_01547 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SID PP-binding_2 ACP_SdgA_C DUF5856 Motif Other DBs NCBI-ProteinID:  SNV77978 LinkDB All DBs Position 1:1668798..1669049 Genome browser AA seq 83 aa AA seqDB search MDKNEIFEQIKVYLEELFDIDPSTVTLESHIVDDLELDSIDAVDLIVHLQNKIKKRVSPE NFKNVRTIGDIVDVIEQLWNKDQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataaaaatgaaatttttgaacaaattaaagtctatttagaagaactatttgatatt gatccaagcaccgttaccctagaatcacacattgttgatgatcttgagttagacagtatt gatgcggttgatctgattgtacatttacaaaataaaattaaaaaacgtgttagccctgaa aatttcaaaaatgtaagaactatcggggatattgttgatgtaattgagcaattatggaat aaagatcaataa

DBGET integrated database retrieval system