KEGG   Pocillopora damicornis (lace coral): 113667438
Entry
113667438         CDS       T05773                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 3-like
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04144  Endocytosis
pdam04310  Wnt signaling pathway
pdam04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113667438
   04350 TGF-beta signaling pathway
    113667438
   04068 FoxO signaling pathway
    113667438
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113667438
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 113667438
NCBI-ProteinID: XP_027039059
LinkDB
Position
Unknown
AA seq 417 aa
MTSLLPFTPPIVKRLLGWKRSTDDDDKWAEKAVKSLVKKLKKTGGLEELERAITNPGIPT
KCVTIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELRPIESCEYAFSLKKDEVCV
NPFHYQRVETPVLPPVLVPRQTTEVPRERPALPEYTRPENTSFPTQEPTNSPFQLPDTPG
YMSEDQCSVSGDQPQSMQTDPGPLSPDPSLADAQPVQYTEPAYWCQISYYEMNTRVGEIF
HAARPSLTVDGFTDPSSCDRFCLGLLSNINRNPQIEMTRKHIGKGVRLYYIGGEVFAECL
SDSSIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAQLLSQSVNQGFEAVYALTR
MCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSAHCSSMS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgacttcgcttcttccttttacgccgcccattgttaagagattgctgggctggaagcga
agtacggacgacgatgataaatgggccgagaaagcagtgaagagtttggtaaagaaattg
aagaaaactggaggccttgaggagctggaaagagcgatcacgaacccgggtattcctaca
aaatgtgtgacaatacctcgcagtttagacggccgtttgcaagtttcgcatcgcaaaggt
ctgcctcatgtgatttactgtcgactatggcgttggccggacttgcaaagccatcacgaa
ttgcgacctatcgagtcgtgtgaatacgcttttagcttgaagaaagatgaagtttgtgtg
aatcctttccactatcagcgagtagaaacaccagttcttccacctgttcttgttccacgt
caaacaactgaagttcccagggaacgtccagcactcccagaatacaccagaccagaaaat
acttcatttcctacccaagagcccactaactccccattccagttgcctgatactccaggt
tatatgtcagaggatcagtgctcagtgtcaggagatcaaccacagagcatgcagacagat
ccaggtcctctatctccagatccatcccttgcagatgcacagcctgtccagtacactgaa
ccagcatactggtgccagatttcatattatgagatgaacacaagagttggagaaattttt
catgcagctcgaccaagtcttactgttgatggctttactgatccctctagttgtgacaga
ttctgtttgggattgttgtctaatattaaccgcaaccctcaaatagagatgacacgtaaa
cacattgggaagggagtccgcctctattacattggtggtgaagtgtttgctgagtgttta
agtgacagtagtatatttgtacagagccccaactgtaatcaacggtatggctggcaccca
gccactgtgtgtaagattccaccgggatgcaacctaaagatctttaataatcaagaattt
gctcagttattgtcacagtctgtcaatcaaggttttgaggcagtgtatgcattaactcgt
atgtgtaccatcagaatgtcgtttgtaaaaggctggggtgctgagtatcgcagacaaact
gtaacaagtacaccatgttggattgagcttcacctcaatggcccccttcaatggcttgat
aaagttcttacacagatgggttctccttctgctcactgttcatcaatgtcctga

DBGET integrated database retrieval system